KEGG   Pusillimonas sp. T7-7: PT7_1650Help
Entry
PT7_1650          CDS       T01486                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00010  Glycolysis / Gluconeogenesis
put00620  Pyruvate metabolism
put00640  Propanoate metabolism
put00680  Methane metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_1650
   00620 Pyruvate metabolism
    PT7_1650
   00640 Propanoate metabolism
    PT7_1650
  Energy metabolism
   00680 Methane metabolism
    PT7_1650
Enzymes [BR:put01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PT7_1650
Lipid biosynthesis proteins [BR:put01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PT7_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AEC20190
UniProt: F4GXE2
Position
1770197..1771549
Genome map
AA seq 450 aa AA seqDB search
MNDQYSALYQSYQWFVPSQFNIAQACVHRWAQNPLEGRRIAIFHENARSQREIWTYTRLS
DTANQLANGLVKMGIQAGDRIAVLTEQRPEAVAAYTAIFSVGAIAVPLPPECEADGLAAR
LQDASIRIAIVDAACASNLLLAQSKYPALAQIIGLDFQHEAIIPWHSLLARQPTSFKAMP
TLSGSPALLLYAPDHGTTAPKGVLLAHHTLIGLLPGFVASQNWFPQSGDIFWSPSGWHSA
GGILNALLPTLYFGHAIVSTASQITPGHAFEIMERYQVSNIFLTPSALQSMMQETPLPHT
HYQLALRAIMASGASLGEDIFKWCQEALGVTPNEVFGQTEMSLLIGNSHKKWPARPGSMG
RPYPGHQLAILDNKGKPCLPGKIGEIALNRYDLHGHIDPVLFLGYWHNEAATQSRFQNDW
CLTGELAQVDDNGYYWYAGRRKGPQGTPQS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaatactcggcgctgtaccagtcttaccagtggtttgtcccctctcaattc
aatatcgcgcaagcgtgcgtgcaccgctgggcgcaaaatccgcttgaagggcgacgtatt
gccattttccatgaaaatgcccggagccagcgtgaaatctggacctatacgcggctttcc
gacacggctaatcaattggccaacggcctggtcaagatgggtatacaagcgggcgaccgc
atcgccgtgcttacagagcagcggcccgaagcggttgccgcttacacggccatattcagc
gtaggcgccattgccgtgccgctgccgcccgaatgcgaggcggacggactcgccgccagg
ctgcaagatgccagtatccggatcgccattgtcgatgcggcctgcgccagcaatttgctg
ctggctcaaagcaagtatccagccctggcgcaaattatcggtctggacttccagcacgaa
gccatcattccgtggcactcgctgctggcgcgccagcccaccagcttcaaggccatgccg
accttatcaggcagcccggcactgttgctttatgcaccggaccacggtacgaccgcaccc
aagggcgtcttgctggcccaccatacactgatcggtctattgcccgggttcgtagcttcg
caaaactggtttccccagtcaggcgatatattctggagcccctcgggctggcactcggca
ggcggcatcctcaacgccctgctgcccacactctatttcggccatgccatcgtcagcaca
gccagccagattacgccgggccacgccttcgaaatcatggagcgctatcaggtcagcaat
atctttcttaccccttcagcactccagtccatgatgcaagaaacgcccttgccacacaca
cattatcaactggccttgcgtgcaatcatggcaagcggagcaagcctgggcgaagacatt
ttcaagtggtgtcaggaagccctgggcgttacacccaatgaagtgtttggccagactgaa
atgagcctgttgataggcaatagccacaagaaatggccagccaggccgggcagtatggga
cgcccatatccggggcatcagcttgccatccttgataacaaaggcaaaccctgccttccg
ggcaaaatcggcgaaatcgcgctgaaccgctacgacctgcacggtcatatcgatccggtg
ctttttttgggctactggcacaacgaagcggccacccagtcccgatttcagaatgactgg
tgcctgaccggcgaactcgcccaggtcgatgataacggttattactggtatgccgggcgc
cgcaaaggcccccaaggaacaccgcagtcatag

DBGET integrated database retrieval system