KEGG   Pusillimonas sp. T7-7: PT7_1677Help
Entry
PT7_1677          CDS       T01486                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
put  Pusillimonas sp. T7-7
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PT7_1677
   00240 Pyrimidine metabolism
    PT7_1677
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PT7_1677
   03430 Mismatch repair
    PT7_1677
   03440 Homologous recombination
    PT7_1677
Enzymes [BR:put01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PT7_1677
DNA replication proteins [BR:put03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PT7_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1799901..1800332
Genome map
AA seq 143 aa AA seqDB search
MSRVDFAFGAPNRLRTACEVVRKHYSAGRRVLVYTQDRQRLERFDHLLWGFDPTAFVPHV
MTDDPLAAQTPVQLTAAPPVASPTADGQQPWLLNLDLSCPPGYEHFDRILEIVSDHEDDK
LAARERWQQYKVAGHALHAHKLG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggtcgactttgctttcggcgcccccaaccgcttgcgcacggcctgcgaggtc
gtacgcaagcactacagcgcgggccgtcgtgtgctggtctatacacaagacagacaaagg
ctggaacgtttcgaccacctgctttggggctttgaccccacagcatttgttcctcatgtc
atgaccgacgacccgctggctgcccagactccggttcagttgacggcagccccgccggtc
gccagtccaaccgcagatgggcagcagccctggctgctcaatctcgacttgtcatgcccg
cccggttacgaacattttgaccgcatccttgagatcgtttccgatcacgaagatgacaag
cttgctgcacgcgaacgctggcaacaatataaagttgccggacatgcgcttcatgcgcat
aaactagggtga

DBGET integrated database retrieval system