KEGG   Pusillimonas sp. T7-7: PT7_1677Help
Entry
PT7_1677          CDS       T01486                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
put  Pusillimonas sp. T7-7
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:put00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:put00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:put03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:put03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:put03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1799901..1800332
Genome map
AA seq 143 aa AA seqDB search
MSRVDFAFGAPNRLRTACEVVRKHYSAGRRVLVYTQDRQRLERFDHLLWGFDPTAFVPHV
MTDDPLAAQTPVQLTAAPPVASPTADGQQPWLLNLDLSCPPGYEHFDRILEIVSDHEDDK
LAARERWQQYKVAGHALHAHKLG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggtcgactttgctttcggcgcccccaaccgcttgcgcacggcctgcgaggtc
gtacgcaagcactacagcgcgggccgtcgtgtgctggtctatacacaagacagacaaagg
ctggaacgtttcgaccacctgctttggggctttgaccccacagcatttgttcctcatgtc
atgaccgacgacccgctggctgcccagactccggttcagttgacggcagccccgccggtc
gccagtccaaccgcagatgggcagcagccctggctgctcaatctcgacttgtcatgcccg
cccggttacgaacattttgaccgcatccttgagatcgtttccgatcacgaagatgacaag
cttgctgcacgcgaacgctggcaacaatataaagttgccggacatgcgcttcatgcgcat
aaactagggtga

DBGET integrated database retrieval system