KEGG   Pusillimonas sp. T7-7: PT7_1712Help
Entry
PT7_1712          CDS       T01486                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00260  Glycine, serine and threonine metabolism
put00400  Phenylalanine, tyrosine and tryptophan biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
put01230  Biosynthesis of amino acids
Module
put_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PT7_1712
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PT7_1712
Enzymes [BR:put01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PT7_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEC20252
UniProt: F4GXK4
Position
complement(1829379..1830443)
Genome map
AA seq 354 aa AA seqDB search
MQEFAYELKHFVGRPSPVYHARRWSDRLGGAQIWFKREDLNHTGAHKINNCIGQMLLARR
MGKPRIIAETGAGQHGVATATVAARYGLECVVYMGSEDVRRQASNVYRMKLLGATVVPVD
SGSRTLKDALNEAMRDWVTNVENTFYIIGTVAGPHPYPMMVRDFQSVIGNECLEQMPVDA
GRQPDYVIASVGGGSNAMGIFHPYISHQDVKLIGVEAAGEGLDTGRHAASLSAGHVGVLH
GNRTYVMQDENGQVQETHSISAGLDYPGVGPEHAWLKDDGRAEYVCINDQEALAAFHDCC
RSEGIMPALESSHALAYALKLAPTLPKDKIILVNLSGRGDKDMHTVADASGISL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggagttcgcctacgaactcaagcatttcgtgggtcgtcccagtccggtctaccat
gctcgccgctggtccgacaggttgggcggcgcgcaaatctggttcaagcgtgaagacctc
aaccataccggcgcacataagatcaacaactgtattggccaaatgctgctggcgcgccgt
atgggaaagccacgtattattgcggaaacgggtgctggccagcatggcgtggcaacggct
actgtggcggcgcgctatgggctggagtgcgtggtgtacatgggtagcgaagatgtacgt
cgccaggcttccaatgtgtaccgcatgaagttgctgggcgccacggtggtgcccgtggat
tcgggctcgcgcacgcttaaagacgccttgaacgaagccatgcgcgactgggtcaccaat
gttgaaaatactttctacattatcggcacggtggcggggccgcatccttaccccatgatg
gtgcgcgacttccaatccgttattggtaacgagtgcctggagcaaatgccggtggatgcc
ggccgtcagcccgattacgttattgcttcggtgggcggcggttccaatgccatgggaatt
ttccatccctacatcagccatcaggatgtaaaactgataggggtcgaggcagcaggcgag
gggctggacaccggacggcatgccgcatcccttagcgccggccacgtgggtgtattgcat
ggcaatcgtacctacgtcatgcaagacgagaatggccaggttcaagaaacgcattcgatt
tcggctggcctcgattatcctggcgtcggtcctgaacacgcctggctgaaagacgatggc
cgcgccgaatacgtgtgcatcaacgaccaggaagcgctggccgccttccacgattgttgc
cgcagcgagggcatcatgcctgcgctggaatcatcacacgctttggcttatgcgcttaaa
cttgcgcccaccctgcccaaagacaaaatcattctggtgaatctgtccggccgcggcgat
aaagacatgcatacggttgctgatgccagcggcatcagcctgtga

DBGET integrated database retrieval system