KEGG   Pusillimonas sp. T7-7: PT7_1849Help
Entry
PT7_1849          CDS       T01486                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PT7_1849
   01230 Biosynthesis of amino acids
    PT7_1849
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_1849
   00051 Fructose and mannose metabolism
    PT7_1849
   00562 Inositol phosphate metabolism
    PT7_1849
Enzymes [BR:put01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PT7_1849
Exosome [BR:put04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PT7_1849
  Exosomal proteins of bladder cancer cells
   PT7_1849
  Exosomal proteins of melanoma cells
   PT7_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963033..1963734)
Genome map
AA seq 233 aa AA seqDB search
MHGLLAANASLLDGLHKGASAAPGCDLAVCVPFPYLDQARTGLQGSVVSWGAQDVSKHEQ
GAFTGEVSAAMLADFDCQWALVGHSERRTLHGETDQLVADKAIAALSAGLTPVVCVGETL
AEQEAGQTEHIIARQLAPVLALGAQQVGRMVLAYEPVWAIGTGRTATPEQAQAVHAYIRS
QLNGLGVPEVRVLYGGSVKASNAASLFAMPDIDGALVGGASLVVEEFLRIAAA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcctgctggccgccaatgctagcctgcttgacggtctgcacaagggtgcatcg
gcagcgcccggatgcgatctggcggtctgcgtgccttttccttaccttgatcaggctaga
actggcctgcagggtagcgttgtttcctggggcgctcaagatgtcagcaagcacgaacag
ggcgcgtttactggcgaggtctcggcggccatgctggcagattttgactgccaatgggcg
ttggttggccattccgaacggcgcaccttgcacggcgaaaccgatcagcttgttgctgac
aaggccatagccgccctgagtgccgggcttactcctgttgtatgcgtgggcgagacgctg
gctgaacaagaagccggtcaaacagagcacattattgcgcgccagttggcgcctgtattg
gcgctgggtgcacaacaagtgggtcgcatggtgttggcttacgagcccgtctgggccata
ggcacaggccgtactgcaacgcctgaacaggcgcaggccgtacatgcctacatccgttcg
caactgaacggcctgggtgttcctgaagtcagggtgctttatggcggcagcgtcaaggca
tcgaatgcagcttcgctgtttgccatgcctgatatcgatggcgctttggtgggcggtgca
tcgctggtggtcgaagaatttttacgtatagcggccgcgtag

DBGET integrated database retrieval system