KEGG   Pusillimonas sp. T7-7: PT7_1908Help
Entry
PT7_1908          CDS       T01486                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
put  Pusillimonas sp. T7-7
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PT7_1908
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PT7_1908
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PT7_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2043574..2044356)
Genome map
AA seq 260 aa AA seqDB search
MLKGKNAVVTGSTSGIGLAIARELAANGANLVINGFGDANAIEKERVNIELEFDVKAHYI
NADLMQAQATRDFIEQSVKVLGSIDILVNNAGIQHTDLIEDFPTDRWDAIIALNLSAVFH
GTAAALPYMKNQGWGRIINIASAHGLVASATKSAYVAAKHGVVGLTKVTALENAGNGVTC
NAICPGWVRTPLVEKQIAALAQKSGIDTEAAAKELLFEKQPSLQFVTPKQLGGAAVFLAS
EAADQMTGTTLSLDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtaaaaatgctgtcgtaacgggttcaaccagcggcattggcttggcgatt
gcccgtgaactggctgcaaacggcgcaaatttagtgatcaatggttttggcgatgcgaat
gccatcgaaaaagaaagggtcaacattgagctggagtttgatgtcaaggctcattacatc
aatgccgatctgatgcaggcccaggccacgcgcgacttcattgaacaatcggtcaaggtg
ctgggcagcatagatatcctggtcaacaatgcaggtatccagcatactgacctgatcgag
gattttccgacagatcgctgggacgccatcattgccttgaacctgtcggcggttttccac
ggtacagcggcggcgctgccttacatgaagaatcagggctgggggcgaattatcaacatt
gcgtccgcccatggactggtggcctcggccaccaagtccgcttatgttgccgccaagcac
ggtgttgtgggcctgaccaaggtgaccgcacttgaaaacgccggcaatggggtaacctgc
aacgcaatctgcccgggctgggtgcggacccccctggttgaaaaacagattgcagccttg
gctcagaaaagcgggatcgatactgaagctgcagccaaagagctgttgtttgaaaagcag
ccttcactgcagttcgtgacgcccaagcagttgggtggcgcagcggttttcctggcctcc
gaggcagccgatcaaatgacaggcaccaccctgtcgctggatggcggctggacagcacgc
taa

DBGET integrated database retrieval system