KEGG   Pusillimonas sp. T7-7: PT7_2005Help
Entry
PT7_2005          CDS       T01486                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
put  Pusillimonas sp. T7-7
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:put00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PT7_2005
Enzymes [BR:put01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PT7_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2136899..2137477
Genome map
AA seq 192 aa AA seqDB search
MIGRITGTLIEKTPPIVCVDVGGVGYEIDVPMSTLYDLPDNGATITLYTHLAVREDAHTL
YGFLSSKERSAFRALIKVTGIGARTALAVLSGMSVDELANAITQQETGLLTRVPGIGKKT
AERLLLELRGKLGGDLAHGAGTVAAGRDDILNALLSLGYSNSETQAALKNLPEGVDVAEG
IRLALKSLARRQ
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattaccggcactctgattgagaaaaccccgcccatcgtttgcgtggac
gtaggcggcgtcggctacgaaatcgacgtacccatgagtaccctgtacgatctgcccgac
aacggcgccaccatcacgctgtacactcatctggccgtacgtgaagacgcccacactctg
tatggcttcttgtcatccaaggaacgtagcgcattccgggcgctgatcaaggtcaccggc
ataggcgccagaacagcgctggccgtactctcgggtatgagcgtcgatgaactggccaac
gccatcacgcaacaagagaccggtctgctgacacgtgtacccggcataggcaagaaaacc
gcagagcgcctgttattggaactgcgcggcaagctcggaggcgatctggcacacggagcc
ggcacggttgcggcgggccgcgacgatattctgaacgctctgctgtcgctgggctattca
aacagcgaaacccaggctgccttgaaaaacctgcccgaaggggtggatgtggctgaggga
atacgcctggcactcaaatcgcttgcccggcggcaatag

DBGET integrated database retrieval system