KEGG   Pusillimonas sp. T7-7: PT7_2123Help
Entry
PT7_2123          CDS       T01486                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00900  Terpenoid backbone biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PT7_2123
Enzymes [BR:put01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PT7_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEC20663
UniProt: F4GQW3
Position
complement(2258995..2259918)
Genome map
AA seq 307 aa AA seqDB search
MALYDVPAPAKINLFLHVTGRRDDGYHTLETVFRFIDLCDSLSFDLRRDGKIERDAGVGL
PGLAAQDDLVLRAARALQKATGTAQGAQIRYEKRIPAGGGLGGGSSDAASALIALNRLWQ
TNLGRDELMALARPLGADVPVFIYGRPAFAQGVGNILSPVDLPERAYLVVHPPQHVSTAD
VFSSPDLTRNTACVKISVFADWQKINAPNNGFYKNGLFGSNDLEPVVFAKHPVVEQAVKC
LSEHGLSARMSGSGACVFVEFVTLQQAQVSRQQIISKMSRENDDAFVQSAWACPGLIDHP
LRHWISS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggctttgtacgatgtgcccgcgccggcaaagatcaatcttttcctgcatgtcacgggt
cgtcgcgacgacggctaccacacgctggaaacggtattccgctttattgatttgtgtgac
agcttaagctttgatttgcgccgtgatggcaaaattgaacgcgatgccggagtaggtctg
ccagggctggcggcacaagatgatctggtgttgcgcgcggcgcgtgcgttgcagaaagct
accggcacagcgcaaggcgcccagattcgttacgaaaagcgtatacctgcaggcggcggc
ctgggaggcgggtccagcgatgcggcctctgcgctgatcgccttgaaccggctttggcaa
actaatcttggccgcgacgagttgatggctttggcacggccgctgggcgccgatgtaccg
gtgttcatatatgggcgtccggcatttgcacagggcgtaggcaatattctgtcgccggtc
gacttgcccgagcgtgcttatcttgttgtgcatccgccgcagcacgtctcgacggcagat
gttttttcatcgcccgatttgacaaggaatacagcttgcgtcaaaatatcggtctttgct
gattggcaaaaaattaatgcacctaataacggtttttataaaaacggtttatttggcagc
aatgatcttgagccagtcgtttttgcgaagcaccccgtagtcgagcaggcggtcaaatgc
ttgtctgaacatgggctcagcgcaagaatgagcggctctggtgcatgtgtttttgttgag
tttgtaactttacaacaggcgcaggtgtccaggcagcaaattatcagtaaaatgtctcgt
gaaaacgatgacgcgtttgttcaaagtgcctgggcttgtccggggctgattgatcatccg
cttcgacactggataagcagttga

DBGET integrated database retrieval system