KEGG   Pusillimonas sp. T7-7: PT7_2125Help
Entry
PT7_2125          CDS       T01486                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
put  Pusillimonas sp. T7-7
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:put00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PT7_2125
Enzymes [BR:put01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PT7_2125
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PT7_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262445..2263221
Genome map
AA seq 258 aa AA seqDB search
MTGKQLKNFVVYEPRMRWPIPDGLAATISGHKVLSCERRGKYLLINFEHGTQIIHLGMSG
SLRRVPASEARRKHDHAEWIFDDARFLLHDPRRFGAVLWHDAAQGPVANHPLLAKLGIEP
FDAQFTSSYLYERLRGRTQAIKQTLLAGDIVVGVGNIYASESLFLARINPRTAAGSLSRA
RCQALMQAIQITLRNALESGGSTLRDYVNATGEPGAYFALHSAVYEKSGQPCQLCATPIK
RIIQGQRATYYCPKCQRR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaacagctgaaaaacttcgtcgtttacgagccgcgcatgcgttggcccata
ccagatggcctggctgcaaccattagcgggcacaaagtgctgtcctgcgagcgtcgcggc
aaatatttgctgatcaatttcgagcatggaacacaaatcatccatttgggcatgtcggga
tccttgcgccgtgtacccgcctccgaagcacgacgcaagcacgaccatgccgaatggata
tttgacgacgcacgctttttactgcacgacccgcgccgtttcggcgcggtgctctggcac
gatgcagctcaaggccctgttgccaaccatccgttgctcgccaaactgggtatagaacct
ttcgatgcccaattcacgtccagttatctatacgaacggctacgcggaagaacccaggcc
attaaacaaacactcctggctggcgacatcgtagtcggagtcggcaatatatatgcttca
gaatccctgtttctggcacgcatcaatccacgcacagccgccggcagcctgtcgcgcgct
cgttgccaagcattgatgcaagccatacaaatcactttgcgcaacgcgctcgaatcgggt
ggcagcaccctgcgcgactacgtcaatgccacgggtgaacctggcgcctattttgccctg
cactcggccgtatacgaaaaatcaggccagccctgccagttatgcgccacacccataaag
cgcatcatccaggggcagcgagccacctactactgcccaaaatgtcagcgccgctga

DBGET integrated database retrieval system