KEGG   Pusillimonas sp. T7-7: PT7_2132Help
Entry
PT7_2132          CDS       T01486                                 

Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_2132
   00030 Pentose phosphate pathway
    PT7_2132
   00051 Fructose and mannose metabolism
    PT7_2132
   00052 Galactose metabolism
    PT7_2132
   00500 Starch and sucrose metabolism
    PT7_2132
   00520 Amino sugar and nucleotide sugar metabolism
    PT7_2132
  Nucleotide metabolism
   00230 Purine metabolism
    PT7_2132
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PT7_2132
Enzymes [BR:put01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PT7_2132
    5.4.2.8  phosphomannomutase
     PT7_2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270435..2271826
Genome map
AA seq 463 aa AA seqDB search
MSNTTNLPKDVFKAYDIRGTVPEQLNADFARLLGLALAQQARAEGVNTLVVGYDGRLSSP
ELSQALQQGLTQGGINTLDLGMVPTPVVYFAAYTQHTGSGVAITGSHNPSNYNGFKIMMA
GRTLHGSDIQKLAQIMAQPESLDGIQPGNSTPLDLLDAYVKEISGTVLPARPMKIAIDCG
NGVGGVVASALYQAMGCTVDELYCQVDGSFPNHHPDPADPANLQDLIRHVQESDCELGLA
FDGDADRLGVVTKSGEIIWPDRQLILFARDVLQRQPGAPIIFDVKCSRHVARAIKQAGGK
PQMSQTGHSLIKAKLAETGAPLAGEMSGHVFFKERWYGFDDGLYAGARLLEILSAYEDPS
AELESLPKDISTPEIKLEMSEGQPHALVARLQKEGKFPSATSISTIDGVRAEYADGFGLA
RASNTTPVIVLRFEGDTEQDIERIKEEFRRALLALEPGISLPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaacaccaccaatctgcctaaagacgtattcaaagcctacgatattcgcggcacc
gtgcccgagcagctcaatgccgatttcgcccgcttgctgggcctggcgcttgcccaacag
gcacgcgccgaaggtgtaaacacactggtcgtgggctacgacgggcgcctgagcagcccc
gaactctcacaagcgctgcagcagggcctgacacaaggcggcatcaacaccctggacctg
ggcatggttcccaccccggtcgtttattttgccgcatacacccagcacaccggttcgggc
gtggcgattacgggcagccacaacccatcgaactacaacggtttcaaaatcatgatggcc
ggccgcaccctgcatggcagcgatattcaaaagctggcgcaaatcatggcgcagcccgag
tcccttgacggcattcagccgggcaacagcacgcctcttgatttgcttgacgcctatgta
aaggaaatcagcggcacggtgctgcccgcccgtcccatgaagatcgccatcgattgcggc
aacggtgtcggcggcgttgtggcatcagccttgtaccaagccatgggttgtaccgtagac
gagctgtattgccaggtggacggcagctttcccaatcaccatcccgatccggcagatccc
gccaacctgcaagacctcatccgccacgtgcaagaaagcgattgcgagctggggctggct
tttgacggcgacgccgaccgccttggggtagtgaccaaatccggcgaaatcatctggccc
gaccgccagctcatactttttgcacgagacgtgttgcagcgccagcccggcgcccccatt
atctttgacgtcaaatgcagccgtcacgtagcacgcgccatcaagcaggcaggcggcaag
ccgcaaatgtcgcaaacaggacactcgctgatcaaggccaagctggccgaaaccggcgct
ccgctggccggcgaaatgagcggccacgtatttttcaaagaacgctggtacggttttgac
gatggcctgtatgccggagcccgactgctcgagatcctgtccgcatacgaagacccatcg
gccgagctcgaatctctgcccaaagacatctccacacctgaaatcaagcttgagatgtca
gaaggtcagccgcatgccctggtggcgcgcctgcagaaagaaggcaagttcccctcggcc
accagcatcagcactattgacggcgtacgcgccgagtacgccgacggctttggcctggcc
cgggcatccaacaccacgcccgtcatcgtcctgcgtttcgaaggcgacaccgagcaagac
atagaacgcatcaaggaagaattccgtcgggccctgttggcccttgagccgggcatctcc
ctgccgttctaa

DBGET integrated database retrieval system