KEGG   Pusillimonas sp. T7-7: PT7_2150Help
Entry
PT7_2150          CDS       T01486                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
put  Pusillimonas sp. T7-7
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PT7_2150
   00670 One carbon pool by folate
    PT7_2150
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PT7_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2290077..2290577
Genome map
AA seq 166 aa AA seqDB search
MPPPIIQLVVAYSENRVIGRDNALPWRLPSDLAHFKRVTLGNPIIMGRNTWISLGRPLPG
RPNLVISRNPEYKAEGASVHPSLDAAVAACISAAADKVCIIGGEQVFRHALDIADEIIAT
EVRAQIDGDTFFPALDSSLWQEIERLPQPEENGLHFDFVTYRRIKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcccccacccattatccagcttgtcgttgcctattcagaaaaccgtgtcattggccgc
gacaacgccctgccctggcgcctgccgtccgatctggcgcacttcaagcgcgttaccttg
gggaaccccatcatcatgggacgcaacacctggatatcgctgggccggccactgcccgga
cggcccaacttggtgatcagtcgcaaccctgaatacaaggccgaaggcgcttcggtccat
ccttcactggacgccgcagtggctgcttgtataagcgcagcggccgacaaggtgtgcatc
ataggtggcgaacaggtgtttcgccacgcactggacatcgccgacgaaatcatcgccacc
gaggtcagggcccagatcgacggcgacacctttttcccagccctggacagcagcctctgg
caagaaattgaaaggctgccgcagcccgaagaaaacggcctgcacttcgacttcgtgacc
tatcgacgcatcaaggcatag

DBGET integrated database retrieval system