KEGG   Pusillimonas sp. T7-7: PT7_2527Help
Entry
PT7_2527          CDS       T01486                                 

Definition
disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
put  Pusillimonas sp. T7-7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2688167..2688886)
Genome map
AA seq 239 aa AA seqDB search
MRTRLKGLLAALALVVSPVMVQAQSATPESVRESFEGRFPGIEAKEVRSTPFPGLFEVQV
GMDLLYTNATADYVLQGALIDAKSRRDLTAERLEELSKVSFSSLPLELAVMQVKGDGSRK
IAVFEDPNCGYCKRLHQTLKEVDNITVYTFLFPILSPDSTVKARDIWCAKDQAATWRAWM
LDGKVPPEAVCDTPVDTVLALGRSLMVQGTPAIIFADGSRVNGALPLDALNQKLAAVKQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacacgattaaaaggcttgttggcggcattggccttggtagtatcgcctgtcatg
gtgcaggcgcagagcgcaacgcccgaatcggtgcgcgagtcattcgagggtcggttccct
ggcatcgaggccaaggaagtaagaagcactccgtttccggggttgttcgaggtgcaggta
ggcatggacctgctgtataccaatgccactgccgactatgtattgcaaggagcgctgatc
gacgccaagagccgccgcgaccttactgccgaaagactggaagagctgtctaaagtatcg
ttttcgtcactgcctcttgaactggcagtaatgcaggtaaaaggcgatggttcgcgcaag
atagcggtttttgaggaccccaactgcggctattgcaagcgtctgcaccagaccttgaaa
gaggtggacaacatcacggtgtacacctttctgtttcccatcctgtcgccggattctact
gtgaaggcgcgtgatatctggtgtgctaaagaccaggcagcaacttggcgcgcctggatg
ctggacggcaaagtacccccagaggcagtgtgcgataccccggttgacaccgtgttggcc
ttgggtcgtagtcttatggtgcagggtacgccggccattatttttgctgatggcagccgt
gtgaatggcgccttgccgctggatgccttgaaccagaagctggcggcggtaaagcagtaa

DBGET integrated database retrieval system