KEGG   Pusillimonas sp. T7-7: PT7_2536Help
Entry
PT7_2536          CDS       T01486                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
put  Pusillimonas sp. T7-7
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PT7_2536
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PT7_2536
Enzymes [BR:put01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PT7_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2696718..2697512
Genome map
AA seq 264 aa AA seqDB search
MNDILAKILETKKSEVATARQMRSESDVLREAKSRKDLRGFARAIEEKIAQGKPGVIAEV
KKASPSKGVIRENFNAVDIATSYAAHGAACLSVLTDVTFFQGSYDYLRQARAACTLPVLR
KDFIIDPYQIVHARALGADCILLIVAALSPQQLREFESLAKELGMDVLVEVHDRSELDIA
LELDTTLLGINNRNLRTFETSLQNTINLLPAVPENKRVITESGILTPDDVALMREHQVHA
FLVGEAFMKAPEPGVALQELFFSH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgccaaaattcttgaaaccaaaaaaagcgaagtcgctactgcacgc
cagatgcgcagtgagtccgacgtcctgcgcgaagccaaaagccgtaaagatttgcgcggc
ttcgcgcgagccatcgaagaaaaaattgcgcagggcaagcccggcgtcattgccgaagtc
aaaaaggcatcgccgtccaaaggcgtcatccgcgaaaatttcaacgcggtcgacattgcc
acttcttatgccgcgcatggcgctgcctgcctgtcagtgctgaccgacgtcacgtttttc
caaggctcctacgactatctgcgtcaggcgcgggcagcatgcacattgccggtcttgcgc
aaagacttcatcatcgacccctatcaaatcgtgcatgcccgtgcgctgggagccgactgc
atcctgctgatcgtggcggcactcagcccgcagcagctgcgcgagttcgaaagcctggcc
aaagagctgggtatggacgtcctggtcgaagtccatgatcgcagcgagctcgacattgcc
ctggaactggataccaccctgctcggcatcaacaaccgcaatctgcgcacatttgaaacc
tcgctgcaaaacaccataaacctgttgccagccgtacccgagaacaagcgcgtgatcact
gaaagcggcatcctgacccccgacgacgtcgccttgatgcgtgaacatcaggttcacgcc
tttctggtgggcgaagcattcatgaaagccccagagcctggcgtcgccttgcaagaactg
ttctttagccactaa

DBGET integrated database retrieval system