KEGG   Pusillimonas sp. T7-7: PT7_2536Help
Entry
PT7_2536          CDS       T01486                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00400  Phenylalanine, tyrosine and tryptophan biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
put01230  Biosynthesis of amino acids
Module
put_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PT7_2536
Enzymes [BR:put01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PT7_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEC21076
UniProt: F4GUA7
Position
2696718..2697512
Genome map
AA seq 264 aa AA seqDB search
MNDILAKILETKKSEVATARQMRSESDVLREAKSRKDLRGFARAIEEKIAQGKPGVIAEV
KKASPSKGVIRENFNAVDIATSYAAHGAACLSVLTDVTFFQGSYDYLRQARAACTLPVLR
KDFIIDPYQIVHARALGADCILLIVAALSPQQLREFESLAKELGMDVLVEVHDRSELDIA
LELDTTLLGINNRNLRTFETSLQNTINLLPAVPENKRVITESGILTPDDVALMREHQVHA
FLVGEAFMKAPEPGVALQELFFSH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgccaaaattcttgaaaccaaaaaaagcgaagtcgctactgcacgc
cagatgcgcagtgagtccgacgtcctgcgcgaagccaaaagccgtaaagatttgcgcggc
ttcgcgcgagccatcgaagaaaaaattgcgcagggcaagcccggcgtcattgccgaagtc
aaaaaggcatcgccgtccaaaggcgtcatccgcgaaaatttcaacgcggtcgacattgcc
acttcttatgccgcgcatggcgctgcctgcctgtcagtgctgaccgacgtcacgtttttc
caaggctcctacgactatctgcgtcaggcgcgggcagcatgcacattgccggtcttgcgc
aaagacttcatcatcgacccctatcaaatcgtgcatgcccgtgcgctgggagccgactgc
atcctgctgatcgtggcggcactcagcccgcagcagctgcgcgagttcgaaagcctggcc
aaagagctgggtatggacgtcctggtcgaagtccatgatcgcagcgagctcgacattgcc
ctggaactggataccaccctgctcggcatcaacaaccgcaatctgcgcacatttgaaacc
tcgctgcaaaacaccataaacctgttgccagccgtacccgagaacaagcgcgtgatcact
gaaagcggcatcctgacccccgacgacgtcgccttgatgcgtgaacatcaggttcacgcc
tttctggtgggcgaagcattcatgaaagccccagagcctggcgtcgccttgcaagaactg
ttctttagccactaa

DBGET integrated database retrieval system