KEGG   Pusillimonas sp. T7-7: PT7_2643Help
Entry
PT7_2643          CDS       T01486                                 

Definition
(GenBank) dihydrolipoamide acyltransferase (E2) component of 2-oxoacid dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00010  Glycolysis / Gluconeogenesis
put00020  Citrate cycle (TCA cycle)
put00620  Pyruvate metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
Module
put_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_2643
   00020 Citrate cycle (TCA cycle)
    PT7_2643
   00620 Pyruvate metabolism
    PT7_2643
Enzymes [BR:put01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PT7_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEC21183
UniProt: F4GV19
Position
complement(2809158..2810459)
Genome map
AA seq 433 aa AA seqDB search
MRQALTLPKLGLTMTEGIVSEWLVQPGAAFVAGDLLYVVENDKVANEIEAEADGSLLETV
VSAGDTVPVGDVIGYWDDGLGESVVSVQETKVQAPADIGSGEPAADTAALAQQKSDSTHQ
DPGGQQAPDGGRRIIATPYARKLAAGQGVSLSGLSGTGPHGRIVARDVEAASTADAQRVA
SGLQQQPQFQPKAEAAVPAPVAVAPGQSLTAPTSMQATIARRLTASKQEIPHFYLALDID
VTRLVTLRKEVNRAQEEHRLTLNHFIVMAVARALRQMPEANRVWTNDGILSFSQIDVGVA
VSTEDGLLAPAVCDVGHVSMGALAERLNAVIERARVGRMNQADLGSPAITVSNAGMHHVH
FMGSIINPGQSMILGVGSVKAVFRPDDEGQPELRQEMGVVLSADHRIIDGVRGLKFLNIV
RELLEQPVRLLVH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcaggcgttgactttgcccaagctgggcctgaccatgaccgaaggcatcgtgtcg
gaatggctggtgcagccaggcgctgcatttgtcgccggtgaccttctctatgtggtcgag
aacgacaaggtcgccaacgagatcgaggccgaggccgacggtagcctgttggaaaccgtg
gtatcggccggcgataccgtgccggtaggcgatgtcattggctattgggatgacggcctg
ggcgaaagcgtggtatctgtacaggaaaccaaggtgcaggccccggcagatattggctcg
ggtgaacccgctgcagacaccgctgcgttggcccagcagaaatctgacagtactcatcaa
gacccaggtgggcagcaagcgcctgatggcggccggcgcattattgcaacgccttatgcg
cgcaaactggcagcaggccagggtgtttccctgagcgggctctcgggtacgggtccccat
ggtcgcattgtggcccgtgatgtcgaggcggcctctaccgccgatgcccagcgtgttgcg
tccgggctccaacagcagccccagttccagcctaaggcagaagccgcagtacctgctccg
gtggctgtcgcgccgggccagtcgctgactgcgccaacgtccatgcaggccaccattgct
cgtcgtctgacggccagcaagcaggaaattcctcacttctatctggcgctggatattgat
gtgacgcgtttggtcacactgcgcaaggaagttaatcgtgcccaggaagagcatcgcctg
acactgaaccattttattgtgatggcggttgcccgggctctgcgtcaaatgcctgaggcc
aatcgtgtctggacaaatgacggcattttgtcgttcagccaaattgacgtgggtgtggcg
gtgagcaccgaagacggtttgttggcgccggccgtgtgtgatgtgggccatgtgtctatg
ggtgcgttggcagagcgtcttaatgctgttatcgagcgggcccgagtgggacgcatgaac
caggcggatctgggcagcccggccattaccgtgtcgaacgcgggcatgcatcatgtgcac
ttcatgggttccatcatcaacccgggtcaatccatgattctgggtgtcggtagcgtcaag
gctgtattccgccccgatgatgaagggcagcccgagctgcgccaggaaatgggcgtggtg
ctgtcggctgatcatcgcatcatcgatggggtgcgaggcctgaagttcctgaatatcgta
agagagttgcttgaacagccggtcaggctgttggtgcattag

DBGET integrated database retrieval system