KEGG   Pusillimonas sp. T7-7: PT7_2783Help
Entry
PT7_2783          CDS       T01486                                 

Definition
D-cysteine desulfhydrase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
put  Pusillimonas sp. T7-7
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PT7_2783
Enzymes [BR:put01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     PT7_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2942772..2943770)
Genome map
AA seq 332 aa AA seqDB search
MHLAAFPRIRLGHFPTPLEFMPNLTKHLGGPNLYIKRDDCTGLATGGNKTRKLEFLVAQA
LEQGADTLITQGAVQSNHARQTVAAAAKVGLQCKILLEQRVSDATEEYEQSGNVLLDRLL
GGDIVGRFPAGTDMQQEMEKLAAELRSAGRKPYVIPGGGSNPVGALGYVGCAQELLNQSF
ETGLRIDHVVHATGSTGTQAGLVVGLRSSNSGIPVYGVSVRAPKDKQEENVWKLVQATVD
YMGLPASSVERADVVANSDYVGDGYGIPTDSMIEALRLTAEQEAILLDPVYSGKGMAGLI
ALIRSGHFKKDENVVFVHTGGAVGLYGYRQLF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgccgccttccctcgtattcgtctcgggcactttcctacaccgctggaattc
atgcccaacctgaccaagcatttgggcggcccgaatctgtatatcaagcgggatgattgc
accggcctggccacgggcggcaataaaacacgcaaactggagtttctggtggcgcaggcg
ctggagcagggcgccgataccctgattacgcaaggcgcagtgcaatcgaatcacgcgcgc
cagaccgtggctgctgcggcgaaggttggcctgcagtgcaagatccttcttgagcagcgc
gtaagcgacgccactgaagaatacgagcagtcgggcaatgtgctgctcgatcgcctgttg
ggcggagacatcgtcgggcgttttcctgcaggcaccgacatgcagcaggaaatggaaaaa
ctggcggctgaactgcgcagcgccgggcgcaagccttatgtcataccagggggcggttcc
aatcctgtcggagcgctgggctatgtgggttgtgcacaagaattgttgaaccagtctttt
gaaaccggcttgcgcatagaccatgtcgtgcatgccacgggcagtactggtacccaagcc
gggctggtggtgggtctgcgcagcagcaatagcggcatacctgtgtacggtgtcagtgtg
cgggcgcccaaagacaagcaggaagaaaatgtttggaaactggtgcaagctactgtagat
tacatgggcctgccggcatcatcggtcgagcgtgccgatgttgtggccaattctgactac
gttggcgatggctacggcatacccaccgatagcatgatcgaagctttgcgcctgacagcg
gaacaagaagccatcttgctggatccggtctattcgggcaaaggcatggccggcttgatt
gcactgatccgttcggggcatttcaagaaggatgaaaacgtggtgtttgtacatactggc
ggtgcggttggcctatacggataccgccagcttttctag

DBGET integrated database retrieval system