KEGG   Pusillimonas sp. T7-7: PT7_2945Help
Entry
PT7_2945          CDS       T01486                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
put  Pusillimonas sp. T7-7
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:put00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3112506..3113270)
Genome map
AA seq 254 aa AA seqDB search
MKQEFRPKDYFDDRVTREMKQHLQRKQRTRDETLATSCRILAMTGQEAGLAGQISARSER
ENAYWTLRFGLGFDEATPNDFIEVDQDLTTISGEGMANPATRFHLWVYRARPDVNAIVHT
HAPWVSTLAAARQELVIIQMDMTPFHNDCAFLADWPGVPIADEEGALISAALGDKRSILL
AHHGYLTVGSTLEEAIYLSVYLERAARMQIRAQTLGPLTPVPDHLAKEAHDYLLKPSIVN
STFDYWCRQAERVR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagaattccggccaaaagattattttgatgaccgcgtcacacgcgaaatgaag
caacaccttcaacgcaagcagcgtacacgcgacgaaaccttggcaacatcctgtcggatt
cttgccatgaccgggcaagaagcaggcctggccggccaaatcagtgcccgctcagagcgc
gagaatgcctactggacactacggttcggcctaggcttcgatgaagccacaccaaatgat
tttatcgaggtcgatcaagatctgactaccatttcgggcgaaggcatggccaaccccgcg
acacgatttcatctttgggtctaccgggccaggccagacgtcaacgccattgtccacacc
catgctccttgggtgtctaccctggctgccgcacgccaggaactcgtcattatccagatg
gacatgacgcccttccataatgattgcgcatttctggctgactggccgggcgtgccgatt
gcagacgaggaaggggccttgatctcggccgccctaggtgacaaacggtcgattctgctt
gcgcatcatggttatctgaccgtaggttccacactcgaagaagccatttatctatcggtt
tacctggaacgcgctgcacgtatgcaaatccgtgcgcaaacattgggcccgctgacccca
gtgccagaccatttagccaaagaagcgcacgattatctgctgaaaccctctatcgtcaac
agcacctttgattactggtgccggcaggctgaaagggtgcgttga

DBGET integrated database retrieval system