KEGG   Pusillimonas sp. T7-7: PT7_3121Help
Entry
PT7_3121          CDS       T01486                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
put  Pusillimonas sp. T7-7
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PT7_3121
  Amino acid metabolism
   00340 Histidine metabolism
    PT7_3121
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PT7_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3289969..3291285)
Genome map
AA seq 438 aa AA seqDB search
MSFIKRLSTQSEQFKQTLHTLLAFDASQDESIEQATADILKNVRAHGDQAVLDYTRRFDR
VSASSMADLEIPRQDWQAALDALPAEQRSALEAAAERVRRYHEHQRAESWSYTEDDGTVL
GQKITPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVPEVIMVTPTPDGVHNPIVLAAAA
LGGVDRVWGIGGAQAVAALAYGTDTIAPVDKIVGPGNAYVAAAKRRVYGTVGIDMIAGPS
EILIIADGSTPADWVAMDLFSQAEHDELAQAILLCPSLEYLNEVEAAIERLLPQMPRADI
IRSSLGNRGALIHVQSMEEACAIANDIAPEHLEISANDPQQWADLIRHAGAIFLGRYSSE
SLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSQEGAQVLGRVAATLAYGEGL
QAHAASAEYRLHTTSTES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcataaaacgccttagcacccagtccgagcagttcaagcaaaccttgcacacg
ctgctggctttcgatgcttcgcaagacgagtccattgagcaggctaccgccgacatcctg
aaaaacgtgcgagcacatggcgaccaggcggtgctggactacacccgacgctttgaccgc
gtatcggcctcgtccatggccgacctcgaaattccgcgccaggactggcaggccgcgctt
gacgccctgcccgccgagcagcgcagcgcgctcgaagcggcggccgaacgcgtgcgccgc
tatcacgaacaccaacgtgccgaaagctggtcttacaccgaagacgacggcaccgtgctg
ggccagaaaatcacgccgcttgatcgcgtgggcctgtatgtgcctggcggcaaggcggcc
tacccgtcatcggtactcatgaatgccataccggccaaggtggccggggtgcccgaagtc
attatggtgacgccaacgcccgacggcgtgcacaacccgattgtgttggcggcggccgcc
ctgggcggagtggatcgcgtctggggcataggcggcgcacaagccgtggccgccctggcc
tacggcaccgataccattgcaccggtcgataaaatcgtcggccccggcaatgcctatgtg
gctgccgccaagcgccgcgtatacggcacagtgggcatagacatgatcgccggccccagc
gaaatattgatcattgccgacggcagcacaccggccgactgggtcgccatggacttgttc
tcgcaggccgagcacgacgaactggcccaggccattttgctgtgccccagccttgagtat
ctgaacgaggtcgaagccgccatcgagcgcctgctgccccaaatgccgcgtgccgacatc
atacgcagcagcctgggcaatcgaggcgcactcatccatgtacaaagcatggaagaagcc
tgtgccattgccaacgacatcgcccccgagcaccttgaaatctcggcaaacgacccacaa
cagtgggccgacctgatccgccacgccggcgccatcttcctgggtcgctacagctcggaa
tcgttgggcgactactgcgccggccccaaccacgttttacccacttcgcgtaccgcccgc
ttttcttcaccgctgggcgtgtatgatttccagaaacgctccagtctgatccaggtctcg
caagaaggcgcacaggtcctggggcgcgtagcggccacactggcttatggcgaagggctg
caggcccacgccgccagtgccgaataccgcctgcacactacttctactgaatcctga

DBGET integrated database retrieval system