KEGG   Pusillimonas sp. T7-7: PT7_3153Help
Entry
PT7_3153          CDS       T01486                                 

Definition
dTDP-6-deoxy-D-glucose-3,5 epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
put  Pusillimonas sp. T7-7
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PT7_3153
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PT7_3153
Enzymes [BR:put01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PT7_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3321929..3322510
Genome map
AA seq 193 aa AA seqDB search
MKIIDTRLAGVKRIELAVFRDDRGCFLESYQQERYAQALGDAVRFVQDNCSHSHRGVLRG
LHYQVEHPQGKLVRVAQGEIFDVAVDLRPGSPTFGQWEGHTLSSAQLALPAAGTVSHIQL
WIPPGFAHGFFTLSETAMVEYKCTDYYHPGDEACLLWNDPELAIAWPDVQPRLSDKDRAG
LSLRALQQAGRLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaagataattgatacgcggttagcaggcgtcaaacgcatcgagctggccgtctttcgt
gacgatcgcggctgctttctggaaagctaccaacaagagcgttatgcgcaagccctaggt
gacgctgtgcgcttcgtgcaagacaactgcagccactcacaccggggcgtattacgcggc
ctgcattatcaggtagagcacccgcagggtaaattagtgcgcgtggcgcagggtgaaatt
ttcgacgtggcggtggatctgcggccaggttcgcctaccttcgggcaatgggaagggcat
acactctcgtccgctcagcttgcattgccagcagcgggcacggtctcgcacatccagctt
tggattccgcccggctttgcgcacggtttttttaccctgtcggaaaccgccatggtcgaa
tacaaatgcacggattactaccatcctggtgacgaagcctgcctgctttggaatgacccc
gagctggctattgcctggccagacgttcaaccacgattatctgacaaagaccgggcaggg
cttagtttgcgggctctgcaacaggcaggccgcctgccatga

DBGET integrated database retrieval system