KEGG   Pusillimonas sp. T7-7: PT7_3216Help
Entry
PT7_3216          CDS       T01486                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00250  Alanine, aspartate and glutamate metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PT7_3216
Enzymes [BR:put01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PT7_3216
Peptidases [BR:put01002]
 Cysteine Peptidases
  Family C44
   PT7_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEC21756
UniProt: F4GPQ1
Position
complement(3384969..3386861)
Genome map
AA seq 630 aa AA seqDB search
MCGLTGFHTLNANTPLHSTAGQMADALTHRGPDDAGVWVDETSGLALAHRRLSILELSAA
GHQPMLSPDQRLVLVFNGEIYNHLALRQQLAAQGQAPDWRGHSDTETLLACVNAWGVQKT
LEASTGMFALALWDRQTRQLVLARDRMGEKPLYWGWQNDVLLFGSELKALRQHPAFRANI
DRQALVSFMRHGYISAPHSIYQDVHKLPAGHSLTLDLADPIKARTAQPMPYWSMAQTVAA
GLQNPFEGTREEAVDALEQQLSASVRSQMLSDVPLGAFLSGGIDSSAIVALMQTHSSRPV
RTFTIGFDDERYNEAPHAAAIARHLGTEHTEMMVQPGDALALIPALPHTYDEPFADSSQI
PTMLVSKMTRAHVTVALSGDGGDELFGGYNTFRFAPGLWRRIQRLPKPLRTMAAPLLGRH
APNDKLHKLSTLLASNDQRDFYRQLSSHWSDPGLLVRNASEASTPLTTPGALPHTDSFEH
EMMAASTVMYMPDDILVKVDRAAMAYSLEVRVPMLDHRVVELAWRMPLDWKIQAGEGKWP
LRQLLYRHVPQSMMDRPKKGFSLPLADWLRGPLREWAQALLDPARLTREGYLNAAPIQQA
WRQHLSGRRDHSQRLWCVLTFQAWLQDQQA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcttgaccggctttcatacactgaacgccaacacacctctgcacagcacggcc
ggccaaatggctgacgctctgacgcatcgcggcccggatgacgcgggtgtctgggtcgat
gaaaccagcggcctggcgctggcccaccgccggctctcaatactggagctgtccgcagcc
gggcatcagcccatgctgtcgcccgaccagcgcctggtgcttgtcttcaatggcgaaatc
tacaaccatctggccctgcgccagcaactcgctgcgcagggccaggcgcccgactggcgc
ggccactccgacaccgaaaccctgctggcctgcgtcaacgcctggggcgtgcagaaaaca
ttggaagccagcacaggcatgttcgccctggcgctttgggacaggcaaactaggcagctg
gtcctggcgcgcgatcggatgggtgaaaagcccttgtactggggctggcaaaacgacgtc
ttgctgtttggctcagagctcaaggccctgcgtcaacaccccgccttccgggccaatatc
gatcgccaggctttggtttctttcatgcggcacggctatatcagcgccccgcacagcatc
tatcaagacgtgcacaaactgccggccggccacagcctgacgctggatctggccgacccc
atcaaggcgcgcaccgcccaacccatgccctactggtcaatggcgcaaaccgtggcggcc
ggcctgcagaaccctttcgaaggtacccgtgaagaggccgtcgatgcactggaacagcag
ctatcagccagtgtgcgcagccagatgctgtccgacgtacccctgggcgctttcctgagc
ggcggcatagacagcagcgccatcgtggccttgatgcaaacgcatagcagccgcccggtg
cgcaccttcaccataggctttgacgacgaacgctataacgaagccccgcatgcggcggcc
atcgccaggcacctgggcaccgagcacaccgaaatgatggtgcagcccggcgatgcgctg
gccttgattcccgcgctgccgcacacctacgacgaaccctttgccgacagctcgcagata
cccaccatgctggtcagcaaaatgacccgcgcacacgtcactgtggcgctcagcggcgat
ggcggcgacgagctgttcggcggctacaacacctttcgatttgcgcccggcctatggcgg
cgcatacagcgcctgcccaagcccctgcgcacgatggcggcgccgctgctgggccgccac
gcccccaacgacaagctgcacaagctctcgaccctgctggccagcaacgaccagcgcgac
ttctatcgccaactcagcagccactggagcgatccgggcctgctggtgcgcaatgcatct
gaagcctccacaccgctgacgacgcccggcgccttgccgcataccgatagtttcgagcac
gagatgatggccgccagcaccgtcatgtatatgcccgacgacatcctggtcaaggtagac
cgcgccgccatggcatacagcctggaggtgcgcgtgcccatgctcgatcaccgcgtggtc
gaactggcctggcgcatgccgctggactggaagatacaggcgggcgagggcaagtggcct
ttgcgccagctgctgtaccggcacgtgccccagtccatgatggacaggcccaagaaaggc
ttttccttgccactggctgattggctgcgcggccccttgcgcgaatgggcccaggccttg
ctggatccggcccggctgacgcgtgaaggctatttgaatgccgcgcccatacagcaggcc
tggcgccagcacctgtctggccggcgcgaccactcgcagcggctgtggtgcgttctgact
tttcaagcctggctacaggatcaacaagcatga

DBGET integrated database retrieval system