KEGG   Pusillimonas sp. T7-7: PT7_3252Help
Entry
PT7_3252          CDS       T01486                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00040  Pentose and glucuronate interconversions
put00052  Galactose metabolism
put00500  Starch and sucrose metabolism
put00520  Amino sugar and nucleotide sugar metabolism
put01100  Metabolic pathways
put01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PT7_3252
   00052 Galactose metabolism
    PT7_3252
   00500 Starch and sucrose metabolism
    PT7_3252
   00520 Amino sugar and nucleotide sugar metabolism
    PT7_3252
Enzymes [BR:put01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PT7_3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AEC21792
UniProt: F4GPT7
Position
complement(3426315..3427154)
Genome map
AA seq 279 aa AA seqDB search
MKPIRKAVFPVAGLGTRFLPATKAMPKEMLPIVDKPLIQYAVEEAIAAGITELIFITGRN
KRAIEDHFDSVPELEAELEAKNKHEMLQIVRNVLPSNVNCIYTRQPAPLGLGHAVLCAAP
IVGDEPFVVLLADDLIDANTSVTQQLIDAAHKHEGSVMAIQNVRPEDTNRYGIISGTQVS
PNTTHISGIVEKPATADAPSTLAVVGRYVLEPEIFQHLRQTQAGVGGEIQLTDGIASLLT
ARSVFGLQYEGLRYDCGSKAGFFQATVELGRKYHGLEVK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcgcaaagctgtatttcccgttgccggcctgggcacccgctttttgccg
gccaccaaggccatgcccaaagagatgcttcccatcgtcgacaagccgctgattcagtac
gccgtcgaagaagccattgccgcaggcattaccgaactgatcttcatcactggccgcaac
aagcgcgccatcgaagaccatttcgacagcgtgcccgagcttgaagccgagctggaagcc
aagaacaaacacgaaatgctgcaaattgttcgcaacgtgctgccttccaacgttaactgc
atttatacacgccaaccggccccgctaggcctgggccatgccgtgctgtgcgcagcaccc
attgtgggcgacgagccttttgtggttttgctggccgacgacctgatcgatgccaacacg
tcggtcacacaacagctgatcgacgcggctcacaagcacgaaggcagcgtcatggccata
caaaacgtccggcccgaagacaccaaccgctacggcattatttcaggtacgcaagtcagc
cccaatacaacccatatttcgggcattgtcgaaaaacccgccaccgccgacgcacccagc
accttggctgtggtgggccgctatgtgctggaacccgagattttccagcatttgcgccag
acccaggcgggtgtaggcggcgagatccaacttactgacggcatcgccagcctgctgacc
gcgcgcagcgtgtttggcctgcaatatgaagggctgcgctacgactgcggcagcaaagcc
ggcttctttcaggccactgttgaactgggacgcaagtaccacggcctagaggtgaaataa

DBGET integrated database retrieval system