KEGG   Pusillimonas sp. T7-7: PT7_3327Help
Entry
PT7_3327          CDS       T01486                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PT7_3327
   01230 Biosynthesis of amino acids
    PT7_3327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_3327
  Energy metabolism
   00680 Methane metabolism
    PT7_3327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PT7_3327
Enzymes [BR:put01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PT7_3327
Exosome [BR:put04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PT7_3327
  Exosomal proteins of melanoma cells
   PT7_3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3492604..3493353
Genome map
AA seq 249 aa AA seqDB search
MHKLVLMRHGESQWNLENRFTGWTDVDLTDTGREQAFQAGKLLKEQGFEFDLAYTSVLKR
AIRTLWIALDAMDSMHTPTGLSWRLNERHYGALQGLNKAETAEKYGDEQVLIWRRAYAIA
PNPLEPDDPRHPRFDRRYAKIAADKLPATECLQDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDGISDDEIVHLNIPTGQPLVYELDDDLRPIRHYYLGDPAEIEAAMAA
VANQGKARK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacttgttctgatgcgccacggcgaaagccagtggaatcttgaaaaccgcttt
acgggctggactgacgtcgacctgaccgataccgggcgcgaacaggccttccaggcaggc
aagctgctgaaagaacaggggtttgagttcgacctggcctatacctcggtgctcaagcgc
gccatacgcacgctctggatagcgctggatgccatggactctatgcacacgcccacggga
ctgagctggcgcttgaacgagcgtcattatggggcgctgcaaggcttgaacaaggccgag
accgcagaaaaatacggtgacgagcaagtcttgatctggcgccgtgcctatgccattgca
cccaatccgctcgagccggacgatccgcgtcatccgcgcttcgaccggcgctacgccaag
atcgcggccgacaagctccccgcaaccgagtgcctgcaagatacggttgcgcgcgttttg
cctttctggaacgaatccattgcgccggccatacgtgcaggacgacgggtgctggttgcg
gcgcatggcaacagcctgcgggcgctgatcaagcatctggacggcatctcggacgacgag
attgtgcatctgaatatccccacggggcagccgctggtgtacgagctcgacgacgatttg
cgtcccatccgtcattattacctgggcgatccggctgaaatcgaagctgcgatggcagcg
gtggccaatcagggcaaggcaaggaaataa

DBGET integrated database retrieval system