KEGG   Pusillimonas sp. T7-7: PT7_3560Help
Entry
PT7_3560          CDS       T01486                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
put  Pusillimonas sp. T7-7
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PT7_3560
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PT7_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3749973..3750329)
Genome map
AA seq 118 aa AA seqDB search
MGLGAAAPAPAAGDAIRGKAIYSRCLACHALAYDRTGPRHCGLFGRKAGSVPGFSYSEAM
KNANITWTEDTLNAFLTAPMKAVPGTSMGYAGIPDPQERSDLIAYLKQQNTSPTCAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgggattgggcgccgcagcaccggcgccggcagcgggtgacgccatacgcggcaaagcc
atctactcccgctgcctggcctgtcatgctttggcttacgaccgtaccggcccaaggcac
tgcggcctgtttggccgcaaggctggcagtgtgcccgggttctcttactccgaagcaatg
aaaaatgccaacattacgtggactgaagacacgctcaacgctttcctgacggcgcccatg
aaagcagtaccgggcacatccatgggatacgcaggcattcccgacccacaagaacgcagt
gacctgatcgcctacctgaagcagcaaaacacctcgcccacatgcgccggtaaataa

DBGET integrated database retrieval system