KEGG   Pusillimonas sp. T7-7: PT7_3560Help
Entry
PT7_3560          CDS       T01486                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
put  Pusillimonas sp. T7-7
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:put00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:put02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3749973..3750329)
Genome map
AA seq 118 aa AA seqDB search
MGLGAAAPAPAAGDAIRGKAIYSRCLACHALAYDRTGPRHCGLFGRKAGSVPGFSYSEAM
KNANITWTEDTLNAFLTAPMKAVPGTSMGYAGIPDPQERSDLIAYLKQQNTSPTCAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgggattgggcgccgcagcaccggcgccggcagcgggtgacgccatacgcggcaaagcc
atctactcccgctgcctggcctgtcatgctttggcttacgaccgtaccggcccaaggcac
tgcggcctgtttggccgcaaggctggcagtgtgcccgggttctcttactccgaagcaatg
aaaaatgccaacattacgtggactgaagacacgctcaacgctttcctgacggcgcccatg
aaagcagtaccgggcacatccatgggatacgcaggcattcccgacccacaagaacgcagt
gacctgatcgcctacctgaagcagcaaaacacctcgcccacatgcgccggtaaataa

DBGET integrated database retrieval system