KEGG   Pusillimonas sp. T7-7: PT7_P033Help
Entry
PT7_P033          CDS       T01486                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
put  Pusillimonas sp. T7-7
Brite
Enzymes [BR:put01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PT7_P033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:complement(13053..13625)
Genome map
AA seq 190 aa AA seqDB search
MIELFQKLLMLLSGLRPAPTKNEPVLDIEPDPVAMSQEGQKVLKYFESCKLKAYWDADGK
AWTVGWGHTGPDVHEGLVITQAQADQLLRQRLSREFVPGVLSAITRSLAQHELDAMVDLA
YNIGVGAFQSSTLVRKFNAGDTDGAADEFLRWNRSGGRVLLGLRRRRKADRCLFLGTTAA
EAIALGAAVT
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctattccagaaactgctgatgttactttcgggcctgcgcccggcgcccact
aaaaacgagccggtgctggatatcgagcccgacccggtcgccatgagccaggaaggccag
aaggtcctcaagtattttgaatcttgcaagctgaaggcttattgggatgctgacggcaag
gcgtggaccgttggctgggggcatacagggccggatgtacatgagggccttgtgatcacc
caggcccaggccgatcagctattgcgacaacggctatccagggagttcgtgcctggtgtt
ctatccgctattacgcgcagcctggctcaacacgaacttgatgccatggttgacctggcc
tacaacatcggcgtaggtgcattccaaagctcgacgttggtacgcaaatttaatgctggc
gatacagatggcgcggctgatgaattcctacgctggaatagatcgggtgggcgggtgctg
ctgggtctacgccggcgccgtaaggctgaccgctgcctgtttctcggcaccacagcagcc
gaggctattgcgctcggggcagcagtcacatga

DBGET integrated database retrieval system