KEGG   Parachlamydia acanthamoebae: PUV_00900Help
Entry
PUV_00900         CDS       T01552                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:puv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PUV_00900
Enzymes [BR:puv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PUV_00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97142..98935)
Genome map
AA seq 597 aa AA seqDB search
MHKLVPHWSTLNALLELEILPYEAYAVAKLSVEHEAPAAFICHLLLSTQNGHLCTRIKQD
VVSPSIDEVWIGEPHQKELIEPLLLHLLDLVKEAVQKRSDDLSQIIYRREHAYYLQKHWQ
QETLWINCVKKVLMPANQWIDSDAIQTEVSHLIDNQKLLPEQAQAILKAAQQNLLLICGG
PGTGKTYTAGQLIKTLWNHLPPEKQKTFQIALAAPTGKAASNLQNSLAKATENLPNWEIP
KAKTLHALLNIIPYKYAKKRSFSPLAADLILIDESSMIDLPMMIQLFSSLKPSAKLILLG
DHHQLPAVGIGSPFRDLRTYMQNKSEYADQVVELKTCLRAELKGILDFAETVKSGDASGA
LTLLENAHLQGIEKVFLDEKMSLSNFYTFFLEKTAPFFSFDNIQNRSPEELLTVFNRVRI
LSPLRKGPFGIETLNHLLLERFMQNHSTLSPFVAPILLTKNDHKSELFNGEIGVLVRLQK
NEGLQPGDYALFPCKAKDGSETIRRIPALLLPQFEYAYCLSVHKSQGSEFDQIFLMLPSG
SEVFGREILYTAVTRAKKYLQIWTDPNTFTMTLKQTSKRLSSFVERMDDLAEPNHPS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaattagttccccactggtcaactttaaatgccttattagaattagagatttta
ccctatgaagcctatgctgttgctaagctcagtgtagaacatgaagctcccgcagccttc
atctgccacctccttttatcaactcaaaatggtcatctctgcacacggataaaacaggat
gtggtttccccttctatcgatgaggtatggattggtgaacctcaccaaaaagagctgatt
gaaccacttcttctacatcttttagatcttgtgaaagaggctgtccaaaaaagatcggac
gacttgtcccaaatcatttaccgaagggaacatgcctactatcttcaaaagcattggcaa
caagaaaccttgtggatcaactgcgtaaaaaaagtgcttatgccagctaatcagtggata
gattcggatgccattcaaactgaagtttctcatttaattgacaatcaaaaacttcttccc
gagcaggcacaagccattctaaaagctgcacaacaaaatctgcttttaatttgtggagga
cctggcactggaaaaacttacaccgcgggtcaattgattaaaacgttatggaatcacttg
ccccccgaaaaacaaaaaacctttcaaattgcgttagcagcccccacaggaaaagccgct
tccaatttacaaaatagtttagcaaaggcaactgaaaatcttccaaattgggaaatccct
aaagccaaaaccttgcatgctctgctaaatatcatcccatataaatatgccaaaaaaaga
agtttttcacctttagctgccgatctcattctaattgatgaaagttccatgatcgattta
cccatgatgattcagcttttttcttctttaaaaccttctgcaaaattgattttattagga
gatcaccatcaattgccagcggtaggaataggaagtccgtttagagatttacgcacatat
atgcaaaacaaatcggaatatgcagatcaagtcgttgaacttaaaacatgcttaagagct
gaattaaaagggattttagattttgcagagaccgtgaaatctggtgatgcgtcaggcgcc
ttaacccttcttgaaaatgcacatttgcaaggtattgaaaaagtatttctggatgaaaaa
atgtctctttccaatttttatacgttttttttggaaaagacggcaccttttttctcgttt
gacaatatccagaatagatccccagaggagcttttgacggtttttaatcgcgttcgcatt
ttatctcctctacgcaagggtccctttggaattgaaacacttaatcaccttcttttagaa
agatttatgcaaaaccactcgactctttctccctttgtcgctccgattttgctgacgaag
aacgatcataaatctgaattatttaatggggaaatcggtgtgttagtacgcttacaaaaa
aatgaaggattacaaccaggagactacgcactttttccctgcaaagcaaaggatggctcg
gagaccattcgacgcattccagctttgttacttcctcaatttgaatatgcctattgctta
tccgtacacaaaagccagggtagtgaatttgatcaaatttttctcatgcttccttctgga
tcagaagtttttggcagagaaattttatatacagctgtcacgcgagcaaagaagtatttg
cagatttggaccgatccaaatacgtttacaatgacattaaaacaaacttccaaacgcctt
tcaagcttcgttgaaagaatggatgacttagctgaaccaaatcatccatcatga

DBGET integrated database retrieval system