KEGG   Parachlamydia acanthamoebae: PUV_01570Help
Entry
PUV_01570         CDS       T01552                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PUV_01570 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PUV_01570 (murA)
Enzymes [BR:puv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PUV_01570 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164501..165904)
Genome map
AA seq 467 aa AA seqDB search
MEILKIKGGARLNGTVKAAGAKNAMTKLLVASLLSDKKCTFYNVPNIGDVEVTVSLCQEI
GMKVNWDREAGCMEVVTPELKTAYVPQRFSGSNRIPILMIGALLGRTDQDIIVPTVGGCA
IGSRTVDFHIDALRKLGASIEYREMKREGAYFAHAHNGLKGTIIHLPYPSIGATENTILA
SVTARGMTVIKNAATEPEIIELILFLQKLGANIFYDVDRTICIQGTRRFYEVEHTVIPDR
IEAASWGMAAIASKGKVFVEGAQHYNMITFLNKIREVGGGFDIKSNGIEFFYDGPLQGGL
HLETDVHPGFMTDWQQPFVVLLTQASGSSVIHETVYENRFGYTEVLGSMGADITLFRQCL
GGKECRFNAQSFCHSIIVKGATPLTGKEIKIPDLRAGFAYVMAALLGSGESTISGLHFLD
RGYENLAGKLQNLGAEASRIKLEKNSSPTFEEIQKPSIPMVAEAQLA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggaaatactcaaaattaaaggcggcgcacgtttaaacggaactgttaaagctgctggt
gcaaaaaatgcaatgacaaagctgcttgttgcgtctttgctctctgataaaaaatgcacg
ttttacaatgttcctaatattggagacgtggaggtcacggtctctctatgccaagaaatc
ggcatgaaggtcaattgggaccgagaagcaggctgcatggaagtcgtcacaccagaactt
aaaaccgcctatgtccctcaacgcttttcaggatctaatcgcatccctattttgatgatc
ggcgcgctcctaggacgaacggatcaagatattatcgttcccactgttggcggttgcgca
atcggaagccgcactgtcgatttccacatcgatgctctacgcaaattgggagcctccatt
gaataccgagagatgaaaagagagggcgcctattttgcacatgctcacaatggacttaaa
ggaacaatcattcaccttccctatccttccataggggctactgaaaataccattttggct
tctgtaactgcgcgtggaatgactgtgattaaaaatgcagcaacagaacctgaaattatc
gaactcattttattcctccaaaagcttggagccaacattttttacgatgtggaccgtacg
atttgcattcaaggaacacgtcgtttttacgaagttgaacacactgttattcctgaccgc
attgaagcggcttcatggggtatggctgccattgcttctaaaggaaaagttttcgtagaa
ggcgctcaacactacaatatgatcacttttttaaacaaaattcgtgaagtaggtggtggt
tttgacattaaaagcaatggcatcgaatttttctatgatgggcctttacagggcggcctt
catcttgagacagatgtccatccaggttttatgacggattggcagcagccttttgtcgtt
cttttaactcaagcatctggttcctccgttatccatgaaacggtttatgaaaatcgtttt
ggttacacagaagttttaggaagtatgggagcggatatcaccttatttagacaatgtctc
gggggaaaagaatgccgattcaatgcacaaagtttctgccacagtattatcgtaaaagga
gcgactcctttgacaggtaaggaaattaaaattcctgaccttcgcgcaggctttgcctat
gtcatggcagcactgcttggatctggcgaaagtacaatttcaggcttacactttttagat
cgcggctatgaaaacctcgcaggaaaactgcaaaaccttggagctgaagcctctagaatc
aagttagagaagaattcttctcctacatttgaagagattcaaaaaccaagtattccaatg
gtcgcagaagcacagcttgcttaa

DBGET integrated database retrieval system