KEGG   Parachlamydia acanthamoebae: PUV_02460Help
Entry
PUV_02460         CDS       T01552                                 

Gene name
folE-A
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:puv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(262424..263110)
Genome map
AA seq 228 aa AA seqDB search
MLELEEKVLSNPFATSHINDSGDEIPYPWNDNHLTDDEKIKNIEYYFEKILLTLGMDVED
DSIRKTPYRYAKMLVKELFPGLNRNNFPKITTQENKFNYRNMLLESHISIHSMCEHHFVP
ILGYCHIAYIPNDRVIGLSKLNRVAHYFARRPQVQERLTRQIKECLSSLLNTPDVAVVID
ASHLCVKMRGVQDADCFTRTYDMGGLFEEDTYRNEFFGAIPKHSEIKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctagagttagaagaaaaagtactctcaaatccatttgctacttcccatattaacgat
tcaggggatgaaattccttatccatggaatgataaccatttaacggacgatgagaaaata
aaaaacatcgaatattattttgaaaaaatcctcctaactcttggaatggatgtcgaggat
gattccattcgaaaaacaccttatcgttatgctaagatgttggttaaggaactctttcct
ggcttgaatcgtaataactttcccaagattaccacacaggaaaataagttcaattatcgg
aatatgctacttgaatctcacattagcatacacagcatgtgtgaacaccattttgtgcct
attttaggttactgtcacattgcttacattccaaatgatcgcgttatcggcctctctaaa
cttaatcgagtggctcattatttcgcgcgaagacctcaagttcaagaaagattaactcgg
caaatcaaagaatgcctgtcttctctcttgaatacccctgatgttgcagttgtgatcgat
gcttctcatttgtgtgtaaaaatgcgaggagtccaagatgctgattgctttactcgcaca
tatgacatgggcggcctcttcgaagaagacacctatcgcaatgagttttttggcgcaatc
cctaaacatagcgaaattaagctctaa

DBGET integrated database retrieval system