KEGG   Parachlamydia acanthamoebae: PUV_02460Help
Entry
PUV_02460         CDS       T01552                                 

Gene name
folE-A
Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00790  Folate biosynthesis
puv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PUV_02460 (folE-A)
Enzymes [BR:puv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PUV_02460 (folE-A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF AdoMet_dc
Motif
Other DBs
NCBI-ProteinID: CCB85196
UniProt: F8KVR0
Position
complement(262424..263110)
Genome map
AA seq 228 aa AA seqDB search
MLELEEKVLSNPFATSHINDSGDEIPYPWNDNHLTDDEKIKNIEYYFEKILLTLGMDVED
DSIRKTPYRYAKMLVKELFPGLNRNNFPKITTQENKFNYRNMLLESHISIHSMCEHHFVP
ILGYCHIAYIPNDRVIGLSKLNRVAHYFARRPQVQERLTRQIKECLSSLLNTPDVAVVID
ASHLCVKMRGVQDADCFTRTYDMGGLFEEDTYRNEFFGAIPKHSEIKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctagagttagaagaaaaagtactctcaaatccatttgctacttcccatattaacgat
tcaggggatgaaattccttatccatggaatgataaccatttaacggacgatgagaaaata
aaaaacatcgaatattattttgaaaaaatcctcctaactcttggaatggatgtcgaggat
gattccattcgaaaaacaccttatcgttatgctaagatgttggttaaggaactctttcct
ggcttgaatcgtaataactttcccaagattaccacacaggaaaataagttcaattatcgg
aatatgctacttgaatctcacattagcatacacagcatgtgtgaacaccattttgtgcct
attttaggttactgtcacattgcttacattccaaatgatcgcgttatcggcctctctaaa
cttaatcgagtggctcattatttcgcgcgaagacctcaagttcaagaaagattaactcgg
caaatcaaagaatgcctgtcttctctcttgaatacccctgatgttgcagttgtgatcgat
gcttctcatttgtgtgtaaaaatgcgaggagtccaagatgctgattgctttactcgcaca
tatgacatgggcggcctcttcgaagaagacacctatcgcaatgagttttttggcgcaatc
cctaaacatagcgaaattaagctctaa

DBGET integrated database retrieval system