KEGG   Parachlamydia acanthamoebae: PUV_02790Help
Entry
PUV_02790         CDS       T01552                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PUV_02790 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_02790 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PUV_02790 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PUV_02790 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PUV_02790 (adhA)
   00626 Naphthalene degradation
    PUV_02790 (adhA)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PUV_02790 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
308002..308991
Genome map
AA seq 329 aa AA seqDB search
MRAMLLEKPKTPLKLVDLPIPEPTSSQVLLQVEACGVCRTDLHIRDGELTHPHLPLILGH
QIVGIVTGVGSKVKNFKIGDCVGVPWLGGCCDACEYCLSGRENLCDHGTFTGYQAQGGFA
EYAVANASFCFPIPAGFSPLQAAPLLCGGLIGYRALRMTGNAKKLGFYGFGSSAHLLTQA
AVYQGKSVYVFTRPGDERTQAFAKTLKAIWAGGTDELPPVELDAAIIFAPAGDLVPTALK
ALAKGGVVVCAGIYMSDIPSFPYSLLYGERMIRSVTNLTRQDGNEFLALASKVPIHSQVN
VYPLEKANQALDDLKQGKVNGSVVLQIKD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaatgttgcttgaaaagcctaaaactcctctgaaacttgtagatcttcctata
cctgagccaacatccagccaagtccttttgcaggtggaagcctgcggggtttgtcgaacc
gatttgcacattcgggatggagagctcacacatccccatctaccactaattttgggccac
caaattgtgggaattgtgacaggggtgggaagtaaggtaaaaaattttaaaatcggagat
tgcgtgggcgtgccctggttagggggctgttgcgatgcttgtgagtattgcctttcggga
cgagaaaatctttgtgatcatgggacctttactgggtatcaagcccaaggtggctttgca
gagtatgctgtcgcgaatgcctcattttgttttccgattcctgccggattttccccattg
caggccgctcccttattgtgtgggggattgattggatatcgagctttaagaatgacgggg
aatgccaaaaagttaggattttacggatttgggtcttcggcgcatttattgactcaagct
gctgtttaccaggggaaaagtgtgtatgtgtttacccgtcctggcgatgaaagaacacaa
gcttttgctaaaacattaaaagctatctgggcaggtgggacggatgaattaccgcctgtt
gaactcgatgcggcgattatcttcgctcccgccggagatttagttcctaccgctttgaaa
gctttagccaaaggtggcgtggtagtttgtgcaggcatctatatgagtgatattccatca
tttccctattctcttctttatggagagcggatgatccgctctgtgacaaaccttacacgc
caggatggcaacgaatttttagctttggcatccaaagttcccatccatagtcaggttaac
gtctatcctttagaaaaggcgaatcaagctttagatgatttaaaacaaggaaaagtaaat
ggttctgtcgttcttcaaatcaaggattaa

DBGET integrated database retrieval system