KEGG   Parachlamydia acanthamoebae: PUV_03200Help
Entry
PUV_03200         CDS       T01552                                 

Gene name
folE-B
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PUV_03200 (folE-B)
Enzymes [BR:puv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PUV_03200 (folE-B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353161..353877
Genome map
AA seq 238 aa AA seqDB search
MTKSKKNKPQLSHEEFEVSQAVAKRAAITRYPSPIKAKKNPMSKQEKIAFIADKFRDIML
ALDLDLTDGSLARTPERVARMYVEEVFSGLDLNEFPRVSFIEDQYQHDERANMVLVKVKF
HSFCEHHFVPMFGTAHVAYIPNGKLIGLSKIPRIVRFFARRPQVQERLGAQIADSLCTLM
DTQDVAVSISAQHFCVIARGIEDENSHTITNVLRGAFDTHEALKNEFFEGVNRKYIQT
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagagtaaaaaaaataagccgcaactttctcacgaagagtttgaagtgagccaa
gctgttgctaaacgcgcggctattacccgttatccatctcccattaaagccaaaaaaaat
ccgatgtctaagcaagaaaagatcgcatttattgctgataaatttcgggacattatgcta
gcattggatcttgatctaacggatggatctcttgcaagaacccccgagagagtagctaga
atgtatgttgaggaggttttttcagggcttgatctcaatgaatttcctcgagtgagtttt
attgaagatcagtatcagcatgatgaaagagcgaatatggtgcttgtgaaagtcaagttt
catagtttctgcgagcatcattttgtgcctatgtttggaacagcgcatgtggcatatatt
ccgaatggtaagttaattggattatccaaaattcctcgcatcgtacggttttttgctcgt
cgtcctcaggtgcaggaaagattgggagcgcaaattgcggatagtttatgcacgctcatg
gatactcaagatgtggcggtttccatttcagcccaacatttttgtgtgatcgcgcgtgga
atcgaagatgagaacagccacacgatcacaaatgtgctgagaggagcgtttgatacgcat
gaagctttaaaaaacgaattttttgaaggcgtaaatcgaaaatatattcaaacctaa

DBGET integrated database retrieval system