KEGG   Parachlamydia acanthamoebae: PUV_04450Help
Entry
PUV_04450         CDS       T01552                                 

Gene name
speB1
Definition
agmatinase 1
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:puv00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484133..485032)
Genome map
AA seq 299 aa AA seqDB search
MQSKHPIGQGIGVAGRYVGLPDPYGQLSGAEIVILPVPFDLTSTYQKGSDKGPAALIEAS
RNMELYDIETDSEVYKKGIYTDQPIQAKTSQDMLQQTHERTKTLLSHNKFVVTLGGEHSI
SYAPIRAHAEHFGSISVLQFDAHADLQDAYEDDPWSHASVMARVKEIPQVDKIVSVGIRS
MSAEELPNLDPPNTFFAHTLDDNKHWIDQVLSKLSDQVYITFDLDAFDSSLMSSTGTPEP
GGLQWNQATQLLKKVAKHKKIVGFDVVELCPNPANLSCDFLAAKLIYKLLSYTFYSNRL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaacaccccattgggcaaggcataggcgttgccggcagatatgtagggctg
ccagatccctacggacaattatcaggtgctgaaatcgtgatcctcccggttccctttgat
ttaacatcgacttaccaaaaaggcagtgacaaaggacctgcggccctaattgaagcttct
cgaaacatggaattgtatgatattgaaaccgattccgaagtctacaaaaaaggcatctat
acagatcagcctattcaagccaagacttctcaagacatgttacagcaaactcatgagcgt
accaagacactcctctcccataacaaatttgtcgttacacttggtggagagcattccatt
tcctacgcccccatacgcgcccatgccgaacactttggttccatctccgttttacaattt
gatgcgcatgcagacctgcaagatgcctatgaagatgatccatggagtcatgcctccgtg
atggcccgtgtaaaagagattccacaagtcgacaaaatagtctctgttggcatacgtagc
atgagcgccgaagagctcccgaatcttgatcctccaaatactttctttgcgcatacgcta
gatgacaacaaacattggatcgaccaagtcctttcaaaactgtcagaccaggtatacatc
actttcgatcttgatgcattcgactcttccttaatgtcatctacaggcacacctgagcca
ggaggattgcaatggaatcaggccacacaacttttaaaaaaggtagctaaacacaaaaaa
attgtgggatttgatgtcgtagaactctgcccaaatcccgccaatctttcttgcgatttt
ttggccgccaagctcatttataaattattaagctatacattttattcaaataggttgtag

DBGET integrated database retrieval system