KEGG   Parachlamydia acanthamoebae: PUV_04720Help
Entry
PUV_04720         CDS       T01552                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PUV_04720
Enzymes [BR:puv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PUV_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513836..514471
Genome map
AA seq 211 aa AA seqDB search
MSRILYLGLKIPKALYRQAIHCPIIKIAPRAFFEPDIIQAFSRFSDYTHLILTSQTAVQL
FLEAAIFFQINADVINTKKIVAVGKKTAAELAKHRFSADFVPLEETAEGIRDLFANWDRT
SLYVFWPHSALSRPLLTDYWKQNGIKHTDCVLYDTFTNHEVTLPDLSTIDEIVFTSPSTV
DAFLERYYHIPRDKKLTSIGPVTAARLVKSL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcatcctctatctaggattaaaaatccccaaagctttatatcggcaagcgatc
cattgtcccatcattaaaatcgctcctcgagcattttttgagcctgatattatacaggct
ttttctcgtttttcggattatacccatcttattttaaccagccaaacagccgttcagcta
ttcttagaagcagctatcttctttcagataaatgcagatgtcatcaatactaaaaagatc
gtggctgtagggaagaaaacagctgccgagctggctaagcaccggttttctgccgatttt
gttccactggaagaaactgcggaagggattagagacttatttgcaaattgggaccgaact
tccttgtatgtgttttggccacattcagcactttctagacccttattgaccgattattgg
aaacaaaatggaattaagcatactgattgtgtcctctacgataccttcacaaaccatgaa
gttacattacccgatctttcaacaatcgatgaaattgtctttacaagcccttctacagta
gatgcctttttagaaaggtattaccatattcctagagacaaaaaattgacatccattgga
cctgtaacagctgccagactggtaaaaagcttgtga

DBGET integrated database retrieval system