KEGG   Parachlamydia acanthamoebae: PUV_04720Help
Entry
PUV_04720         CDS       T01552                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:puv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513836..514471
Genome map
AA seq 211 aa AA seqDB search
MSRILYLGLKIPKALYRQAIHCPIIKIAPRAFFEPDIIQAFSRFSDYTHLILTSQTAVQL
FLEAAIFFQINADVINTKKIVAVGKKTAAELAKHRFSADFVPLEETAEGIRDLFANWDRT
SLYVFWPHSALSRPLLTDYWKQNGIKHTDCVLYDTFTNHEVTLPDLSTIDEIVFTSPSTV
DAFLERYYHIPRDKKLTSIGPVTAARLVKSL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcatcctctatctaggattaaaaatccccaaagctttatatcggcaagcgatc
cattgtcccatcattaaaatcgctcctcgagcattttttgagcctgatattatacaggct
ttttctcgtttttcggattatacccatcttattttaaccagccaaacagccgttcagcta
ttcttagaagcagctatcttctttcagataaatgcagatgtcatcaatactaaaaagatc
gtggctgtagggaagaaaacagctgccgagctggctaagcaccggttttctgccgatttt
gttccactggaagaaactgcggaagggattagagacttatttgcaaattgggaccgaact
tccttgtatgtgttttggccacattcagcactttctagacccttattgaccgattattgg
aaacaaaatggaattaagcatactgattgtgtcctctacgataccttcacaaaccatgaa
gttacattacccgatctttcaacaatcgatgaaattgtctttacaagcccttctacagta
gatgcctttttagaaaggtattaccatattcctagagacaaaaaattgacatccattgga
cctgtaacagctgccagactggtaaaaagcttgtga

DBGET integrated database retrieval system