KEGG   Parachlamydia acanthamoebae: PUV_06950Help
Entry
PUV_06950         CDS       T01552                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:puv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:puv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:puv00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:puv00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:puv00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756893..757663
Genome map
AA seq 256 aa AA seqDB search
MSFDICRSRARLPLARLVFSRYPKKIKEEKAMNKLILMRHGQSEWNRLNLFTGWVDIPLS
PLGIEEALVGGDRIKDIPIDIIYTTSLMRAQMTAMLAMSRHTSGKTPVILHPGQGKLQEW
GKIYSKTAEESCIPVICAWELNERMYGELQGLNKAETAEKFGADQVKIWRRSFDVPPPNG
ESLEMTAARSIPYFEENILPQLQEGKNVFVSAHGNSLRSIIMYLDQLSREEVLNLELATG
EPIFYMFQDGKVIRES
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgatatttgtcgatcgagggccagattaccgcttgctcgtttagttttttca
cgctatcctaaaaagatcaaagaggagaaagctatgaataagctcattttaatgcgccat
ggacaatcggaatggaaccgtctgaatctctttactggctgggtagatatccctctttca
cctcttggtattgaagaagctttggtggggggagatcgaattaaagacatcccgattgat
atcatttatacaacatcactcatgcgtgcgcaaatgactgctatgcttgccatgagtcgc
catacatcgggaaaaactcccgtgattcttcatcctgggcaaggaaaactccaagagtgg
ggaaagatctatagtaagactgcagaagagtcgtgtattccagtgatatgtgcttgggaa
ctaaatgagcgaatgtatggcgaactgcaaggattaaataaagctgaaactgccgaaaaa
tttggagctgatcaagtaaaaatatggcgtagaagttttgatgttccgcctccaaacggg
gaaagtttggagatgacagctgcgcgttcaattccttattttgaagaaaatatccttcct
cagctacaagaaggcaaaaatgtttttgtgtctgcgcatggaaattccttacgttcgatc
atcatgtacttagatcagttgtcgcgggaagaagtattaaatcttgaattagccactgga
gagcctattttctatatgttccaagatggtaaagtaatcagagagtcttaa

DBGET integrated database retrieval system