KEGG   Parachlamydia acanthamoebae: PUV_07640Help
Entry
PUV_07640         CDS       T01552                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PUV_07640 (fadJ)
   01212 Fatty acid metabolism
    PUV_07640 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PUV_07640 (fadJ)
   00650 Butanoate metabolism
    PUV_07640 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PUV_07640 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PUV_07640 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PUV_07640 (fadJ)
   00310 Lysine degradation
    PUV_07640 (fadJ)
   00380 Tryptophan metabolism
    PUV_07640 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PUV_07640 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PUV_07640 (fadJ)
   00281 Geraniol degradation
    PUV_07640 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PUV_07640 (fadJ)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PUV_07640 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PUV_07640 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PUV_07640 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851146..853293
Genome map
AA seq 715 aa AA seqDB search
METAFTFSLLPGGIGQLVFNLPHEKVNVLSPPVLEELENLIEQLDPSSGVKLLLITSGKE
HQFVAGVDLKKLEPVFQDPSQGEKILALGHRAYKKLSELPFPTIAAIDGACLGGGLELAL
ACKYRIVSDHPKTALGLPETQLGIMPGWGGTQRLPRLIGLSSALGMILNGKTVNGVKAYK
MKLADSVAAWEFFPEKSLEFARNILKPEFAQKVLNRRKQSGIQNFLLEKNPAGRALIFYQ
AKKQVLDKTHGFYPAPLVALETIKQTYTLPLNEGLEIEQKNFVENIPTKFMNAKNLVKVF
FQNESLKKDAGISIQATPRPVKSAGVLGAGTMGGGLIFLFSYHDIPVRFKDINWEAVAKG
YSHVYSLFKKMIELKKLDKDQAILKFQQASGTIDYTGFKQLDLVVEAATENLELKHTLLN
ELESQLRPDAIIASNTSSLTIAQMASVMKHPERFVGMHFFNPPNRMPLVEVVKGTQTSDE
AIATAVETCRRLGRTPIVVGDCQGFLVNRIFVMGANEIVRFLEKGNSIEKIEKTMLDFGM
PMGPFHLSDEVGNDVSCKVSHIFEETYGKRMQVPELIERMNQKGLFGKKTEKGFYLYDSK
KPTVNPEVQKIVEVIGQPKEELSSEEMVDRSIFLMINEAARCLTEKIVQKPSDIDMALIL
GTGFPPFRGGLLRYADSRGIQTVVDRLKEFEQKEGARFSPCELLLEMAKENRNFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgcttttacattttcactcctgccaggaggcattggccaactcgtttttaat
cttccacatgaaaaagtgaatgttttgtcaccgccagttcttgaagagctcgaaaattta
atcgagcagcttgatcccagttcaggtgtcaagttactcctcattacaagtggcaaagag
catcagtttgtagcgggagttgaccttaaaaaacttgagcccgtttttcaggatccttcc
caaggggaaaaaattttggctttaggtcaccgtgcttataaaaagctttcagaattgcct
tttccaaccattgccgccattgatggggcctgtttaggaggtggcttagaactcgcactt
gcatgtaaatatcgaatcgtttctgatcatccgaaaacagcattaggccttccagagact
caactggggatcatgcctggatggggaggaacgcagcgtttaccacgtttaattgggctt
tcatctgctttaggaatgattttaaatgggaagacggtgaatggtgtaaaagcgtacaaa
atgaagctcgctgattctgtcgctgcttgggagttttttcctgaaaaaagtctggaattt
gctcgaaatattttaaaaccggagtttgcgcaaaaagttttgaaccgtcgaaaacaaagt
ggcatccaaaattttctgttagaaaaaaatccggcaggaagagctcttatcttttatcaa
gctaaaaagcaggtcctagacaaaacgcatggattttaccccgcaccccttgttgctctc
gagacaatcaagcaaacttacacgcttcctctcaatgaagggttggaaatcgagcagaaa
aatttcgtagaaaatattcccaccaaatttatgaatgccaaaaatttggttaaggtgttt
ttccaaaatgaatcccttaaaaaagatgcgggcatttctatccaagcaactcctagaccc
gtgaaatctgcaggtgttttaggcgcgggaacgatgggtggaggtttaatctttttgttt
agctatcatgacatccctgtgcggtttaaggatattaactgggaagctgtcgcgaagggc
tacagccatgtatacagcctgttcaaaaagatgatcgagctgaaaaaactcgataaagat
caggccatcttaaagtttcaacaagccagtggcactatcgattacacgggctttaaacag
cttgatcttgtcgtggaggcggctacggaaaatttggaacttaaacatactttacttaat
gaattggaaagtcagctacggccagatgccatcatcgcctctaatacctcttcattaact
attgcgcaaatggcatccgtgatgaagcatcctgaacgatttgtggggatgcactttttc
aatccccccaatcggatgcctcttgtagaggttgtcaaggggacccaaacatctgatgaa
gccatcgcaacagctgtggaaacatgccgtcggttaggtcggacacctattgtggtgggt
gattgtcaaggatttctcgtgaatcgcatttttgttatgggagctaatgagatcgtgcgt
tttcttgaaaaaggcaattcaatagaaaaaattgaaaaaactatgcttgactttggaatg
cccatggggccttttcatctgtcagatgaagttggaaatgatgtatcttgcaaagtttct
catatatttgaagagacctatggtaagcggatgcaagttccagaacttattgaaagaatg
aatcaaaaagggcttttcgggaaaaaaacagaaaagggcttttatctttatgatagcaaa
aagccaacagttaatccggaagttcagaaaatcgttgaagtcatcggacaaccaaaagaa
gagctttcatccgaagaaatggttgatcgttccatctttttaatgatcaacgaagcggca
cgatgcttgaccgaaaagattgtgcaaaagccctcagacattgacatggctctcattttg
ggaacaggttttccgccgtttagagggggattacttcgttatgctgattcacgtggaatt
caaaccgtggtggatcgactcaaagaatttgagcaaaaagagggggcgcgtttttctcct
tgcgaactcttacttgaaatggcaaaagagaatcgcaatttttattga

DBGET integrated database retrieval system