KEGG   Parachlamydia acanthamoebae: PUV_10290Help
Entry
PUV_10290         CDS       T01552                                 

Gene name
folP-B
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PUV_10290 (folP-B)
Enzymes [BR:puv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PUV_10290 (folP-B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127359..1128150
Genome map
AA seq 263 aa AA seqDB search
MSKAKLMGILNVTPDSFFDGGRYKDTEKAIARGLQMEHDGADILDIGGESTRPGSLSVSE
EEELARVVPVIQALRLQTKCVLSIDTMKPLIAAAAIEAGASLINDVGGFGIPLMREIAAS
FDVDVCVMHMQGEPRTMQQNPAYKEGVVPHLMHWFEHRVNELKKNGVKEERIILDPGIGF
GKTVDDNLQIIQNLSLFKSMGFRVLLGASRKSFLSKIVNKSSADVLSETIAVNVIGLQQG
VDIIRVHDVKEHRGVIDLMERFV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggctaaattaatgggaattttaaatgtgactccagattcattttttgatggg
ggaagatacaaagatacagagaaagccatagcccgtggattgcaaatggagcacgatgga
gctgatattttagatattggaggagaatccactcgtcccgggtctttatctgtttctgaa
gaagaagaattagctcgcgttgtccctgttatccaagctcttcgtttacaaacaaaatgt
gtgttgtcgatcgacaccatgaaacctctgattgcagccgccgctatcgaggcaggggca
tctcttatcaatgatgtgggtggatttggcattcctctcatgcgagaaattgcagcctct
tttgatgtggacgtttgtgtgatgcatatgcaaggtgagcctcgcacgatgcaacaaaat
cctgcttataaagagggcgtagtgcctcatttgatgcactggtttgaacaccgtgtgaat
gaattaaaaaaaaatggtgtaaaagaagaaagaattattctagatcctggcatcggattt
ggaaaaacggttgatgataatcttcaaattatacaaaatctatccttgttcaagtcgatg
ggttttcgtgttttgttgggagcatcacgcaagtcttttctttccaaaatcgtgaataaa
tcctctgcggatgttttgtcggagacgatcgctgtcaatgtcataggtttacagcagggt
gtcgacataattcgtgtgcatgatgtaaaagaacatcgtggagttatagatctcatggag
agatttgtttaa

DBGET integrated database retrieval system