KEGG   Parachlamydia acanthamoebae: PUV_11120Help
Entry
PUV_11120         CDS       T01552                                 

Gene name
DWF5
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    PUV_11120 (DWF5)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     PUV_11120 (DWF5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1227212..1228534)
Genome map
AA seq 440 aa AA seqDB search
MRSTPTVYDHMRTSLKTLVPFLLITLCPPSAILFWYTNVSLDGSFVNLWQQIQHQGFFPL
LYKVWSPFFFGTQTAWTILAIFAASQLFFMKALPGKIYXGPITPKGNVPIYKANGPFAYF
LTLTLFLVCSYGLEWFSPTILYDNLGPLLGALNIFSLFFCLFLYIKGYVAPSSSDAGASG
NPIFDYYWGTELFPRLLGWDVKMFTNCRFGMMSWPLLLISFAAKQQELYGLSDSMVVAVL
LQLIYITKFFFWETGYLRSLDIMHDRAGYYICWGCLVWVPGVYTSPTLYLVNHPNHLGLP
LAALIFALGAVSIMINYLADRQRQKVRESDGNCTVWGKKPFLTVANYTTGDGKQKKNILL
ASGWWGISRHFHYVPEILGAFFWSVPALFANFLPYFYVVFLTILLIERAFRDDRRCALKY
GEDWETYCKHVPYKIIPYMV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtacacctaccgtttatgaccacatgcggacttcattaaaaactctggttcct
ttcttattgattacgttatgccctccatcagcgattttgttttggtatacgaatgtgtcg
cttgacggatcatttgtcaatttgtggcaacagatccagcaccaaggattttttcctttg
ctttacaaagtttggtccccgtttttctttggaacgcaaacggcctggacaatcttggcc
atttttgcagcttcgcagctattctttatgaaagcactgcctggaaaaatctaccrgggt
cccattaccccaaaaggaaatgttcccatttataaagcaaacggtccatttgcatacttc
ttaaccttgacactctttcttgtttgttcctatggacttgaatggttttcacctacaatc
ctatatgacaatttaggaccattgctaggagcattaaatattttcagtctatttttctgc
ttgtttctctatatcaaaggttatgtagcaccctcttcaagtgatgctggtgcttctggc
aatccgatttttgattattattggggcacagaacttttcccgcgtttacttggttgggat
gttaagatgtttacgaattgccgttttggaatgatgagctggccgctacttctgatttct
tttgcagccaaacaacaagaactctacgggttaagcgattcaatggtcgtagccgtgctt
ttacagttgatctacatcacaaaatttttcttttgggaaacaggctacctgcgttcactt
gacattatgcacgatcgtgccggctattacatttgctggggatgtttagtgtgggtcccg
ggggtttatacctctccaactctttaccttgtgaatcaccccaaccacttgggccttcca
ttagcagccctaatctttgccctcggagccgtttctattatgatcaattatctggcagac
cgacaaagacaaaaagtacgtgaaagtgatggaaattgcaccgtatggggtaaaaagcca
tttttgacagtggccaattacaccacaggtgatggaaaacaaaagaaaaatattctgctg
gcttctggctggtggggaatttcgcgccattttcactacgttccagaaatactaggagcc
tttttctggagtgtcccggctttatttgcaaacttcctaccctatttttacgttgttttt
ttaacaatcttattaatagagcgcgccttccgagacgatcgtcgytgtgcacttaaatat
ggcgaagattgggagacctattgcaagcacgtcccctacaaaattattccttatatggtc
taa

DBGET integrated database retrieval system