KEGG   Parachlamydia acanthamoebae: PUV_11650Help
Entry
PUV_11650         CDS       T01552                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00630  Glyoxylate and dicarboxylate metabolism
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01200  Carbon metabolism
Module
puv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PUV_11650 (aceA)
Enzymes [BR:puv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PUV_11650 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCB86115
UniProt: F8KYZ2
Position
complement(1301494..1302777)
Genome map
AA seq 427 aa AA seqDB search
MHPHQNAEDLERDWKTNPRWKNIQRPYTAQEVIKLRGSIHIDRPLARMGAEKLWNLLEKE
PFVRALGALTGNQALQQVQAGLKAIYVSGWQVAADANDAAQVYPDLSLYPLLSVPHLINR
INNAFIRADQIQHLENNGNPIDWFIPIVADAEAGFGGPLNAFKLIKAMIEAGAAAIHLED
QLSSLKKCGHMGGKVLVPASIAIQKLVTARFAADLLGIPTLIIARTDAESATMIRSDADA
VDQPFLKGQRSSEGYYYLKEGIQYAVARGCAFAPYADLVWCEVSKPDLGEAREFAAGIHE
KFPGKWLAYNCSPSFNWQKHLDEHAAREFQEKLAELGYKFQFVTLAGFHTLNASMFELAH
QYNKEGMGAYAKFQKHEFEMEKEQGYKAIKHQKFVGAGYFDEILQTLSSGQSSTSSLKNS
TEEQQFS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcacccacatcaaaatgctgaagatttagaacgtgattggaagaccaatccccgctgg
aaaaatattcaacgtccctataccgctcaagaagtcatcaaactaagaggctccattcat
attgatcgccctttagcaagaatgggagcagaaaagctttggaatctcttagaaaaagaa
ccgtttgtcagagctctaggggctttaacgggcaatcaagctctacaacaagtccaggcg
ggattaaaagcaatatatgtgagcggttggcaagtcgcggcggatgccaatgatgctgct
caggtttatccagatttaagcctctatccccttttgagtgttccgcatctaattaatcgc
attaacaatgcttttattcgagccgatcaaattcagcacctcgaaaataatggaaatcca
atcgattggtttattccaattgtcgcggatgccgaagcgggatttggagggccgttaaat
gcatttaagctaattaaagccatgatcgaagccggagctgccgctattcacttagaagat
cagttgtcctctttaaaaaaatgtggccatatgggaggaaaagtccttgtccccgcttca
attgccattcaaaaacttgtaacagcccgttttgctgcagatcttttagggattcccact
ttgattatcgcccgaacagatgcagaatcagctacgatgattcgctccgatgctgatgcc
gttgaccaaccgttcttaaaaggacagagatccagcgaaggttattattatttaaaagaa
ggcatacaatatgctgtggcgcgtggctgcgcttttgctccatacgctgatttagtttgg
tgtgaagtcagcaaacccgatctcggtgaagctcgcgagtttgcggcaggtattcatgaa
aaatttccaggcaaatggctcgcttataattgctcaccctctttcaactggcaaaaacat
ttagatgagcatgccgcccgtgaattccaagaaaaattagcggagcttggttataaattc
caatttgtgacacttgctggattccataccttaaatgcaagtatgtttgaattggctcat
cagtataacaaagaaggaatgggtgcatatgccaaattccaaaaacacgaatttgaaatg
gaaaaagagcaaggatataaagccatcaaacaccaaaaattcgtaggcgctggttacttc
gatgaaatcctgcaaacgttgtcaagtggccaatcgagtaccagttctttaaaaaattcc
actgaagagcagcagttttcatag

DBGET integrated database retrieval system