KEGG   Parachlamydia acanthamoebae: PUV_11660Help
Entry
PUV_11660         CDS       T01552                                 

Gene name
mls
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PUV_11660 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PUV_11660 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    PUV_11660 (mls)
Enzymes [BR:puv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PUV_11660 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1302787..1304388)
Genome map
AA seq 533 aa AA seqDB search
MKLEKPSVVTTLQIGKIQDRILIPEAIQFLTELHKEFNGRRKQLLQKRVERQKQLNQGIL
PTFLPETAAIRDDLTWNIPPPPSDLQKRAVEITGPVERKMMINALNSGANXFMADFEDAL
SPTWKNVIEGQSNLIDAVNRTISFISPENKSYALKDEIATLMVRPRGWHLNEKHFQIDGE
EISGSLFDFGLYFFHNARRLIRQGSGPYFYLPKLENHEEARLWNDVFLFAQDFLSIPQGT
IRATVLIESILAIFEAEEILYELREHSAGLNAGRWDYIFSIIKKFQKKEDPLLPDRSQIT
MEVPFMQAYTKRIVQICHKRDAHAIGGMAAFIPSRDNPEVTHQALEKIKEDKLRECHGGF
DGTWVAHPALVAIAKGIFEEILKDQPHQIQKKFQSSEVSAHDLLDFKVPNGKITEKGVRQ
NVRISLLYMESWLNGVGAAALDHLMEDAATAEISRAQLWQWIHHHPAAQLPDGRTVSAEL
LKQFFEEEQQKIIAEAKDKNRPHLTEAKKILESIVMKKAFVEFLTLISYEHLT
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagagaaaccatctgttgtcaccactttgcaaatcgggaaaattcaagatcgc
attcttattcctgaagccattcaatttttaacggaattacataaggaatttaatgggcga
cggaaacaacttttgcaaaaaagagtcgaaagacagaagcaactcaatcaggggattctg
ccaacttttcttccggaaacagcggctattcgagatgatctaacttggaacattccccca
ccaccttcagatttgcagaaaagagccgttgaaatcacaggtcctgttgaacgcaaaatg
atgattaacgccctcaattctggggctaatrttttcatggcagactttgaggatgctctc
tctcccacttggaaaaatgtgatcgaagggcaaagcaacttgattgatgctgtgaaccgt
accatttcatttatttcacctgaaaataaatcatacgctttaaaagatgaaattgccacc
ttaatggttcgtcccaggggatggcatcttaatgaaaagcattttcaaattgacggagaa
gaaatttcaggcagcttatttgattttggtctgtatttcttccacaatgcgagaagactc
attagacagggatccggcccctacttttatcttccgaaacttgaaaaccacgaagaagca
cgcttatggaacgacgtttttctctttgctcaagatttcttgagtatccctcagggaacg
attcgtgcaaccgtattaatcgaaagcattttggctatttttgaggcagaagaaatttta
tacgaactcagagaacactctgccggtttgaacgcgggtcgttgggattacatttttagc
attatcaaaaaatttcaaaaaaaagaagaccccttacttccggatcgttcccaaattaca
atggaagttccttttatgcaggcttacacaaaaagaattgtgcaaatctgccataaaaga
gacgcacatgcaattggaggaatggctgcttttattcccagccgtgataatcctgaagtt
actcaccaggctctcgaaaaaattaaagaagataaattgcgcgaatgccatgggggattt
gatggaacatgggtcgcacatccagctctagttgcaattgctaaaggaatttttgaggaa
atcttaaaagatcagcctcaccaaattcaaaaaaaattccagagttcagaagtctctgcc
catgatctcttagatttcaaagttcctaacggaaaaattacagaaaaaggggttcgtcaa
aacgtgcgtatttccctgctgtatatggaatcttggttaaacggagtcggtgccgctgca
cttgaccatttgatggaagatgctgccacagcagaaatttcacgtgcacagctatggcaa
tggatccatcaccatcccgcggctcaacttcccgatgggcgcacagtttcggctgaactt
ttgaaacagttttttgaggaagagcaacaaaaaatcattgcggaagccaaagataaaaat
cgaccgcatttgactgaggctaaaaagatcttggaatcgattgtgatgaaaaaagctttt
gtggaatttttaactttaatttcttatgaacatctcacttga

DBGET integrated database retrieval system