KEGG   Parachlamydia acanthamoebae: PUV_11660Help
Entry
PUV_11660         CDS       T01552                                 

Gene name
mls
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:puv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:puv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:puv00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1302787..1304388)
Genome map
AA seq 533 aa AA seqDB search
MKLEKPSVVTTLQIGKIQDRILIPEAIQFLTELHKEFNGRRKQLLQKRVERQKQLNQGIL
PTFLPETAAIRDDLTWNIPPPPSDLQKRAVEITGPVERKMMINALNSGANXFMADFEDAL
SPTWKNVIEGQSNLIDAVNRTISFISPENKSYALKDEIATLMVRPRGWHLNEKHFQIDGE
EISGSLFDFGLYFFHNARRLIRQGSGPYFYLPKLENHEEARLWNDVFLFAQDFLSIPQGT
IRATVLIESILAIFEAEEILYELREHSAGLNAGRWDYIFSIIKKFQKKEDPLLPDRSQIT
MEVPFMQAYTKRIVQICHKRDAHAIGGMAAFIPSRDNPEVTHQALEKIKEDKLRECHGGF
DGTWVAHPALVAIAKGIFEEILKDQPHQIQKKFQSSEVSAHDLLDFKVPNGKITEKGVRQ
NVRISLLYMESWLNGVGAAALDHLMEDAATAEISRAQLWQWIHHHPAAQLPDGRTVSAEL
LKQFFEEEQQKIIAEAKDKNRPHLTEAKKILESIVMKKAFVEFLTLISYEHLT
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagagaaaccatctgttgtcaccactttgcaaatcgggaaaattcaagatcgc
attcttattcctgaagccattcaatttttaacggaattacataaggaatttaatgggcga
cggaaacaacttttgcaaaaaagagtcgaaagacagaagcaactcaatcaggggattctg
ccaacttttcttccggaaacagcggctattcgagatgatctaacttggaacattccccca
ccaccttcagatttgcagaaaagagccgttgaaatcacaggtcctgttgaacgcaaaatg
atgattaacgccctcaattctggggctaatrttttcatggcagactttgaggatgctctc
tctcccacttggaaaaatgtgatcgaagggcaaagcaacttgattgatgctgtgaaccgt
accatttcatttatttcacctgaaaataaatcatacgctttaaaagatgaaattgccacc
ttaatggttcgtcccaggggatggcatcttaatgaaaagcattttcaaattgacggagaa
gaaatttcaggcagcttatttgattttggtctgtatttcttccacaatgcgagaagactc
attagacagggatccggcccctacttttatcttccgaaacttgaaaaccacgaagaagca
cgcttatggaacgacgtttttctctttgctcaagatttcttgagtatccctcagggaacg
attcgtgcaaccgtattaatcgaaagcattttggctatttttgaggcagaagaaatttta
tacgaactcagagaacactctgccggtttgaacgcgggtcgttgggattacatttttagc
attatcaaaaaatttcaaaaaaaagaagaccccttacttccggatcgttcccaaattaca
atggaagttccttttatgcaggcttacacaaaaagaattgtgcaaatctgccataaaaga
gacgcacatgcaattggaggaatggctgcttttattcccagccgtgataatcctgaagtt
actcaccaggctctcgaaaaaattaaagaagataaattgcgcgaatgccatgggggattt
gatggaacatgggtcgcacatccagctctagttgcaattgctaaaggaatttttgaggaa
atcttaaaagatcagcctcaccaaattcaaaaaaaattccagagttcagaagtctctgcc
catgatctcttagatttcaaagttcctaacggaaaaattacagaaaaaggggttcgtcaa
aacgtgcgtatttccctgctgtatatggaatcttggttaaacggagtcggtgccgctgca
cttgaccatttgatggaagatgctgccacagcagaaatttcacgtgcacagctatggcaa
tggatccatcaccatcccgcggctcaacttcccgatgggcgcacagtttcggctgaactt
ttgaaacagttttttgaggaagagcaacaaaaaatcattgcggaagccaaagataaaaat
cgaccgcatttgactgaggctaaaaagatcttggaatcgattgtgatgaaaaaagctttt
gtggaatttttaactttaatttcttatgaacatctcacttga

DBGET integrated database retrieval system