KEGG   Parachlamydia acanthamoebae: PUV_11830Help
Entry
PUV_11830         CDS       T01552                                 

Gene name
cga
Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUV_11830 (cga)
Enzymes [BR:puv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PUV_11830 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1336783..1339155
Genome map
AA seq 790 aa AA seqDB search
MMDAIAPGEPGILPRWTSSAKIGVGTAASGDSNVWFTISHGILNEVYFPRIDVANIRDFG
FIVTDGATFFSEEKRHAVHEYQLLEDGIPAYLLTNTCYEGRYRIEKKIIADPHRNVLLQE
VTFYPLIGTFADYHLYALIAPHIRNAGMGNYARTGHYKCTPSLFAERAGTVLACASSSPF
IQMSCGFVGISDAWQDLSENKRLTQCYTTAQNGNISLVGEIDLQACQGKFVIALGFANQI
EEAGLQIRASLFQDFNFPLKEYMNGWRQVQKCFIDLSTVDTEGGSLYRISTAVLKIHAGK
HFSGSVIASLSIPWGVYRGDNDIGGYHLIWPRDQVQTALAFLSAGDLESAKQALLFLMCT
QERDGHWLQCMWEDGTPYWKGFQLDETALPILLADQLKRADALIGIDPFEMVEVAAKFIV
KNGPGTEQGRWEEDGGFSPYSIATAIAALLAAADFFEQKGRSEEADYLRKTADDWNDKIE
DWLYAKNTSLAEALGIEGYYVHLAPISYYLQSLPENKQVVIRNRPVEESLANYDDIVGVD
ALALVRFGLRSANDPRILNTVKAIDALLRTETSKGPVWHRYNEDGYGEKEDGTPYDGTGI
GRGWPLLVGERAHYELAKGDRDEAIRLLRVMRAFAGEGGMLPEQVWDVETIPEKFLFNGH
STGAAKPLVWAHGEYISLLRSIKENRIFTMPPQTFHRYIEQKQASTHTIWRFDFPVTAMQ
QEKTLRIQTDVPMIVRWTEDEWVSYQEQSSQMSNLGVSYVDIDFKNNIVFTFFWKDSNRW
EGKNYEIVRI
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgcaattgccccgggagaaccaggaattttacctcgttggacttcaagtgcc
aagataggagtaggaacagcagcctcgggggatagtaatgtttggtttacaatttcgcat
ggaattttaaatgaagtctattttccgcgaatcgatgtcgcaaacatccgagattttgga
tttatcgtcacagatggtgccacttttttctctgaagaaaaaagacatgccgtgcatgaa
tatcaactgttggaagatggcattcctgcttatctattgaccaatacatgctatgaaggg
cgttatcgaatcgaaaaaaaaatcatcgcagatccacatcgcaatgtcttgttgcaagaa
gtcacgttttatcctttaatagggacatttgccgattaccatctttatgccttaatcgca
cctcatattcgtaatgcaggaatgggaaactacgcacggactggtcactacaaatgcaca
ccctctttatttgcagaaagagcggggactgtccttgcatgtgctagctcttctcctttt
attcaaatgtcatgcggttttgtaggaattagcgatgcttggcaagatctctctgaaaat
aaaaggctgacacagtgctacaccacggctcaaaatggcaatattagtttagttggcgaa
atcgatttacaagcctgccaaggaaaatttgtgattgccttgggttttgcgaatcaaatt
gaagaagcgggattgcaaatcagagcttctctatttcaagattttaattttcctttaaaa
gagtacatgaatggatggaggcaggtacaaaaatgctttatagatttaagcactgttgat
acagaaggtggaagcctatacagaatcagtacagctgttttgaagattcatgctggtaag
catttttcaggaagtgtcattgcaagtttgtctattccgtggggtgtttatcgaggagat
aacgacattgggggctaccatctcatttggccgcgcgatcaagtccaaacagctttagct
tttctatcggcaggtgatttagaaagtgcaaagcaagccttgctttttctgatgtgcaca
caagaaagggacgggcattggctacaatgtatgtgggaagatggtacgccttattggaaa
ggattccagctggatgaaacagctttacctattttattggcagaccaattaaaacgagcc
gacgctcttattgggatagatccatttgaaatggtggaagttgcagctaaatttattgtg
aagaatggccctggaacggagcaagggaggtgggaggaggatgggggattttcaccgtat
agcatcgccacagcaattgcagctcttttggctgcagccgatttttttgagcaaaaagga
aggagcgaagaagccgactatttgcgaaaaacagccgatgattggaatgataaaattgag
gattggctctatgccaaaaatacgtcattggcagaagcacttgggatagaaggctattac
gtccacttggctcccataagctattatttacaatctcttccagaaaataaacaagtggtg
attcgcaatcgtcccgttgaggaaagtcttgcaaattacgatgacattgtaggcgtcgat
gcgttggctttggttagatttgggctaagatctgccaatgatccacggattttaaataca
gtaaaggcgattgatgccctgctgaggacagaaacatctaaaggtcccgtttggcatcgg
tataacgaagatggctatggagaaaaagaagatggcactccctatgatgggacaggaatt
ggaagaggatggcccttattagtaggtgagcgtgcgcattatgaactggccaaaggggat
cgagacgaagcaatacgtttattgcgtgtgatgcgtgcatttgcaggtgaaggggggatg
cttcctgagcaagtctgggatgttgaaaccattccggaaaaatttttattcaatggccac
tcaactggtgccgcaaaaccgcttgtttgggcacatggagaatatatttctctcttgcga
tccattaaggagaatcgaattttcacaatgcccccacaaacatttcatcgatatattgag
caaaagcaggcatctacccataccatttggcgttttgactttcctgtcacagctatgcaa
caagaaaagacattaagaatccagacagatgttccaatgattgtgcgttggacagaggat
gaatgggtaagctatcaagagcagagttcacaaatgagtaacctaggggtgtcctatgtg
gatatcgattttaaaaataacattgtttttacgttcttttggaaagatagtaatcgttgg
gaaggaaagaattatgagatagtaaggatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system