KEGG   Parachlamydia acanthamoebae: PUV_12300Help
Entry
PUV_12300         CDS       T01552                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PUV_12300 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PUV_12300 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    PUV_12300 (sucA)
   00380 Tryptophan metabolism
    PUV_12300 (sucA)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PUV_12300 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1388468..1391215
Genome map
AA seq 915 aa AA seqDB search
MTSYNALIQSGFANLALIDEMYAKFQADPHSVDSSWRHLFEEAKPGATQTFPSDRRGIDQ
MLIDQVAAGGVRIYHLIEAYRTYGHYMAKVNPIATAPIEEPWQLKLETLGFTPEELSHRF
PTCGLLNEASATLQELINCLREIYCENIGIEYMGLENPDMEKWLQNHIEPTRFKIELTFE
QKRLILQHLNKSELFELFLHTKYTGQKRFSLEGGETLIPILDAIIEKGSQEGVEEFVLGM
AHRGRLNVLSNILDKSYADIFSEFDEGYIPDSFEGSGDVKYHKGFSSNVQTATGHKVRVE
MPPNPSHLESVDAVVEGEVYARQILASDHETKKKVLPILVHGDAAISGQGVCYETMQMYD
LPGYSTGGTIHVVINNQIGFTTLPRDSRSTHYCTDIARTFRAPVFHVNAEDPEACVYATL
LAVQLRQKYRCDVFIDLNCYRKFGHNETDEPAYTQPYQYQLIRQKKPIRELYRDNLIHQG
ILEKQMAESLEHEFKESLQKALQETKIPTEKVKKVKSEDADELFVTYPTGVPQDTLVEVT
EKLSTIPPDFHIHRKLENLIQDRRQMGIGQKSVDWGMAETLAYGTLLWDGVSVRISGQDV
CRGTFSHRHAMWVDQQTDQPYFPLQHLKEKQGRFNIYNSPLSEYAVLAFEYGYSIGNPKA
LVIWEAQFGDFANGAQIVIDQYISAAEEKWGQKVGLVMLLPHGYEGQGPEHSSARIERFL
TLAGDCNMQIVNPTTPAQFFHLLRRQTMLASLKPLVVFTPKGLLRHPAAQNPIQDFVNGS
FQDIYDDPRASKKVKTLLFCSGRFYYDLDEERKKQGVEDMVIVRIEQLYPLNVKKLLEII
KKYEGFSRCAWVQEEPRNMGAWNFIRPKLREILPSTLELEYIGRACKASPAVGSYALHKQ
EHAEIIQAIFGKKAK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctataatgctttaattcaatcaggctttgctaatttagctttgatcgacgaa
atgtatgcaaaatttcaggcagatcctcacagtgtggattcctcctggcgtcatttgttt
gaagaggctaaaccgggagcgactcaaacctttccctcagatagaagagggatcgatcag
atgcttatcgatcaagtcgcagctggtggagtgcgcatctaccacttaattgaggcctat
cggacatatgggcattacatggctaaagttaatccaatcgctacagctccgatcgaggaa
ccgtggcagctcaagctagagactttaggttttactccagaagaactgtctcatcgtttt
cccacttgtggacttttgaatgaagcctctgcaacccttcaggaattgattaactgctta
cgcgagatttactgtgaaaacatcgggattgaatacatgggattggaaaatcctgacatg
gaaaagtggttgcaaaatcacattgagcccacacgctttaaaattgagctgacatttgag
caaaagcgcttgattctgcagcatttaaataagtcggaattatttgaactctttctgcac
acaaagtatacaggacaaaaaagattttccttagagggtggagagactcttattccaatc
ctagatgcgattattgagaaaggaagccaagaaggggtggaagagtttgtattgggtatg
gctcatcgaggacgtttaaatgttctcagtaatattttggacaaatcttatgccgatatt
ttttcagaatttgatgaaggatatattccagactcttttgaagggagtggagatgttaaa
tatcacaaaggcttctcttccaatgtgcaaacagctactgggcataaagtgcgtgtggag
atgccccccaatccgagccatttagaatcggtcgatgcggtagtggaaggggaagtttat
gctcgtcaaatcctcgctagcgatcatgaaacaaagaaaaaagtgctccctattttggta
catggggatgcagctatttctgggcaaggagtttgttatgaaactatgcaaatgtatgat
ttgccaggctattcgactggcggaacaatccatgtcgtgattaacaatcaaatcggattt
accacgttgccgcgtgactctcgctcaactcattattgtacagacattgcacggacattt
cgtgcgcctgtttttcatgtgaatgcggaagatcccgaggcgtgtgtgtacgcgactctt
ttagctgtgcagttaaggcaaaaatatcgatgtgatgtatttattgatttaaactgctat
cgcaaatttggccacaatgaaactgatgaacctgcgtatactcagccgtatcaataccaa
ctgattcggcaaaaaaagcctattcgagagctatatcgagacaatttgattcaccaaggg
attctagaaaaacaaatggctgaatctttagaacacgagtttaaagagtcgttacaaaaa
gctttgcaagaaacgaaaataccgaccgaaaaagtcaagaaagttaaatccgaagatgca
gatgagttgtttgtcacttatccgacgggtgttccacaagatactttagtagaagtaacg
gaaaagctcagcacaattccgcccgattttcatattcaccgaaagctcgaaaatttgatt
caagatcgtcgtcagatgggaatcggtcaaaagtctgttgattggggaatggccgaaaca
cttgcttacggtactctgctatgggatggtgtgagtgtcagaatttctgggcaggatgtt
tgccgaggaactttcagtcatcgtcacgctatgtgggttgatcaacagacggatcagccc
tattttccgcttcaacatttaaaggagaaacaaggtcgctttaatatctacaactcgcca
ctttctgaatatgctgttttagcttttgaatatgggtatagcattggaaatccgaaggct
ttggtgatttgggaggcacaatttggagattttgcgaatggtgcgcaaattgtgatcgat
caatacatttctgccgcagaagaaaaatggggccagaaagtgggcttggttatgctttta
ccacatggctatgaaggtcaaggacccgaacattcctctgcacgtatcgaaagatttttg
accctcgcgggggattgcaacatgcaaattgtcaatccgacgacgcctgctcaattcttc
catctcttacgtcggcaaacgatgcttgcttccttaaagcctctggtggtttttactcca
aaggggctcttacgccatcctgctgctcagaatcccatccaagattttgtgaatggctct
ttccaagacatctatgatgatcctcgcgcatcaaagaaagtgaaaacgcttctgttttgt
agtggacgcttttactatgatctcgatgaagagcgcaaaaaacaaggggtggaggacatg
gtaattgtacgcatcgagcagctgtatcccctcaacgtgaagaaattattagagattata
aaaaaatatgaagggtttagccgctgtgcttgggtacaagaagagcctcgcaatatggga
gcttggaactttattcgaccaaaattgcgagaaattcttccctcaactctcgaattagag
tatataggaagagcttgtaaagcttccccagccgttggatcatacgctttgcataaacaa
gaacatgccgaaatcatccaagccatctttggaaagaaggcaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system