KEGG   Parachlamydia acanthamoebae: PUV_12300Help
Entry
PUV_12300         CDS       T01552                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PUV_12300 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PUV_12300 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    PUV_12300 (sucA)
   00380 Tryptophan metabolism
    PUV_12300 (sucA)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PUV_12300 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1388468..1391215
Genome map
AA seq 915 aa AA seqDB search
MTSYNALIQSGFANLALIDEMYAKFQADPHSVDSSWRHLFEEAKPGATQTFPSDRRGIDQ
MLIDQVAAGGVRIYHLIEAYRTYGHYMAKVNPIATAPIEEPWQLKLETLGFTPEELSHRF
PTCGLLNEASATLQELINCLREIYCENIGIEYMGLENPDMEKWLQNHIEPTRFKIELTFE
QKRLILQHLNKSELFELFLHTKYTGQKRFSLEGGETLIPILDAIIEKGSQEGVEEFVLGM
AHRGRLNVLSNILDKSYADIFSEFDEGYIPDSFEGSGDVKYHKGFSSNVQTATGHKVRVE
MPPNPSHLESVDAVVEGEVYARQILASDHETKKKVLPILVHGDAAISGQGVCYETMQMYD
LPGYSTGGTIHVVINNQIGFTTLPRDSRSTHYCTDIARTFRAPVFHVNAEDPEACVYATL
LAVQLRQKYRCDVFIDLNCYRKFGHNETDEPAYTQPYQYQLIRQKKPIRELYRDNLIHQG
ILEKQMAESLEHEFKESLQKALQETKIPTEKVKKVKSEDADELFVTYPTGVPQDTLVEVT
EKLSTIPPDFHIHRKLENLIQDRRQMGIGQKSVDWGMAETLAYGTLLWDGVSVRISGQDV
CRGTFSHRHAMWVDQQTDQPYFPLQHLKEKQGRFNIYNSPLSEYAVLAFEYGYSIGNPKA
LVIWEAQFGDFANGAQIVIDQYISAAEEKWGQKVGLVMLLPHGYEGQGPEHSSARIERFL
TLAGDCNMQIVNPTTPAQFFHLLRRQTMLASLKPLVVFTPKGLLRHPAAQNPIQDFVNGS
FQDIYDDPRASKKVKTLLFCSGRFYYDLDEERKKQGVEDMVIVRIEQLYPLNVKKLLEII
KKYEGFSRCAWVQEEPRNMGAWNFIRPKLREILPSTLELEYIGRACKASPAVGSYALHKQ
EHAEIIQAIFGKKAK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctataatgctttaattcaatcaggctttgctaatttagctttgatcgacgaa
atgtatgcaaaatttcaggcagatcctcacagtgtggattcctcctggcgtcatttgttt
gaagaggctaaaccgggagcgactcaaacctttccctcagatagaagagggatcgatcag
atgcttatcgatcaagtcgcagctggtggagtgcgcatctaccacttaattgaggcctat
cggacatatgggcattacatggctaaagttaatccaatcgctacagctccgatcgaggaa
ccgtggcagctcaagctagagactttaggttttactccagaagaactgtctcatcgtttt
cccacttgtggacttttgaatgaagcctctgcaacccttcaggaattgattaactgctta
cgcgagatttactgtgaaaacatcgggattgaatacatgggattggaaaatcctgacatg
gaaaagtggttgcaaaatcacattgagcccacacgctttaaaattgagctgacatttgag
caaaagcgcttgattctgcagcatttaaataagtcggaattatttgaactctttctgcac
acaaagtatacaggacaaaaaagattttccttagagggtggagagactcttattccaatc
ctagatgcgattattgagaaaggaagccaagaaggggtggaagagtttgtattgggtatg
gctcatcgaggacgtttaaatgttctcagtaatattttggacaaatcttatgccgatatt
ttttcagaatttgatgaaggatatattccagactcttttgaagggagtggagatgttaaa
tatcacaaaggcttctcttccaatgtgcaaacagctactgggcataaagtgcgtgtggag
atgccccccaatccgagccatttagaatcggtcgatgcggtagtggaaggggaagtttat
gctcgtcaaatcctcgctagcgatcatgaaacaaagaaaaaagtgctccctattttggta
catggggatgcagctatttctgggcaaggagtttgttatgaaactatgcaaatgtatgat
ttgccaggctattcgactggcggaacaatccatgtcgtgattaacaatcaaatcggattt
accacgttgccgcgtgactctcgctcaactcattattgtacagacattgcacggacattt
cgtgcgcctgtttttcatgtgaatgcggaagatcccgaggcgtgtgtgtacgcgactctt
ttagctgtgcagttaaggcaaaaatatcgatgtgatgtatttattgatttaaactgctat
cgcaaatttggccacaatgaaactgatgaacctgcgtatactcagccgtatcaataccaa
ctgattcggcaaaaaaagcctattcgagagctatatcgagacaatttgattcaccaaggg
attctagaaaaacaaatggctgaatctttagaacacgagtttaaagagtcgttacaaaaa
gctttgcaagaaacgaaaataccgaccgaaaaagtcaagaaagttaaatccgaagatgca
gatgagttgtttgtcacttatccgacgggtgttccacaagatactttagtagaagtaacg
gaaaagctcagcacaattccgcccgattttcatattcaccgaaagctcgaaaatttgatt
caagatcgtcgtcagatgggaatcggtcaaaagtctgttgattggggaatggccgaaaca
cttgcttacggtactctgctatgggatggtgtgagtgtcagaatttctgggcaggatgtt
tgccgaggaactttcagtcatcgtcacgctatgtgggttgatcaacagacggatcagccc
tattttccgcttcaacatttaaaggagaaacaaggtcgctttaatatctacaactcgcca
ctttctgaatatgctgttttagcttttgaatatgggtatagcattggaaatccgaaggct
ttggtgatttgggaggcacaatttggagattttgcgaatggtgcgcaaattgtgatcgat
caatacatttctgccgcagaagaaaaatggggccagaaagtgggcttggttatgctttta
ccacatggctatgaaggtcaaggacccgaacattcctctgcacgtatcgaaagatttttg
accctcgcgggggattgcaacatgcaaattgtcaatccgacgacgcctgctcaattcttc
catctcttacgtcggcaaacgatgcttgcttccttaaagcctctggtggtttttactcca
aaggggctcttacgccatcctgctgctcagaatcccatccaagattttgtgaatggctct
ttccaagacatctatgatgatcctcgcgcatcaaagaaagtgaaaacgcttctgttttgt
agtggacgcttttactatgatctcgatgaagagcgcaaaaaacaaggggtggaggacatg
gtaattgtacgcatcgagcagctgtatcccctcaacgtgaagaaattattagagattata
aaaaaatatgaagggtttagccgctgtgcttgggtacaagaagagcctcgcaatatggga
gcttggaactttattcgaccaaaattgcgagaaattcttccctcaactctcgaattagag
tatataggaagagcttgtaaagcttccccagccgttggatcatacgctttgcataaacaa
gaacatgccgaaatcatccaagccatctttggaaagaaggcaaagtaa

DBGET integrated database retrieval system