KEGG   Parachlamydia acanthamoebae: PUV_12310Help
Entry
PUV_12310         CDS       T01552                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyLLysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00020  Citrate cycle (TCA cycle)
puv00310  Lysine degradation
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01200  Carbon metabolism
Module
puv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
puv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PUV_12310 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PUV_12310 (sucB)
Enzymes [BR:puv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PUV_12310 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: CCB86181
UniProt: F8KZ58
Position
1391235..1392416
Genome map
AA seq 393 aa AA seqDB search
MKEEIKVPAMGESITEATVGTLIKPSGSTVQVDDEILELETDKVNQVLYAKASGVLTLQV
KPGETVTIGQVVGFVDTEAKATQGSASEPQATVPKTEEKAQAKPQEAPQPSQGIRYGKEA
FLEDVVKPEQKDFPQSVPVGKTREQEIPQLEEEAPPPKKMEGRETRRKMSQIRKVIANRL
VEAQQTTAMLTTFNEIDFSAIMAAREKYKDAFLKKHGVKLGFMSFFVKAVVSALREVPDL
NSYIDGNEIVHREYFDIGIAVGTDRGLIVPVLRNCEQLSFAEVEKDIEAYAKKAREGRLA
VDDLQGGGFTITNGGIYGSLLSTPILNPPQCGILGMHKIEKRAVVVDDQIVIRPMMYVAL
SYDHRIVDGKEAVTFLVHVKNALEDPSRLLIEV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaaatcaaagtccctgcaatgggagaatcgattactgaagcaactgtggga
accttaatcaaaccgtctggttcaacagttcaagttgatgatgaaattttggaattggaa
actgacaaggtcaatcaggttctttatgctaaagcatctggagtgttaactttgcaggtc
aaaccaggagagacagttacaattggtcaggtcgtcggctttgtagatacagaagcaaaa
gcaacacaaggctcagcgtcagaacctcaagctactgttccaaaaaccgaagaaaaagct
caagccaaaccgcaagaagctccacagccttcacagggcattcggtatggaaaagaggcg
tttttagaggatgtggtaaaacctgaacaaaaagattttccacaatctgtgcctgtggga
aaaacacgtgaacaagaaattccacagctagaagaagaggctccccctcctaaaaaaatg
gaagggcgcgaaacgcgacgtaaaatgtctcagatacgcaaagtgattgcgaatcgattg
gtagaagctcaacaaaccacagccatgctaacaacctttaatgagatcgatttttcagct
atcatggctgctcgagagaaatacaaagatgcttttctaaaaaaacatggtgtgaaatta
ggctttatgtctttttttgttaaggctgtggtatctgctctaagagaagtccccgatttg
aattcctatattgatggaaatgagatcgtccatcgcgaatattttgatattggaattgcg
gtcggaacagatcgtggcttaatcgtgcccgttttacgtaattgtgaacaactttctttt
gcagaagttgaaaaagatatcgaagcttatgccaaaaaagcccgcgaaggtcgactcgct
gtggatgatttgcaagggggaggttttactattaccaatggcgggatttatggttctctt
ctctccacgcctatcctcaatcctccgcagtgtggcattttagggatgcataaaatagaa
aaaagagcggttgttgtggatgatcagattgtgattcggcccatgatgtatgtagcttta
agctatgatcatcgcatcgtcgatggaaaagaagccgtgacctttttagtgcatgtcaaa
aatgccttggaagatccctcaagactattaattgaggtgtaa

DBGET integrated database retrieval system