KEGG   Parachlamydia acanthamoebae: PUV_12310Help
Entry
PUV_12310         CDS       T01552                                 

Gene name
sucB
Definition
dihydrolipoyLLysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PUV_12310 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PUV_12310 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PUV_12310 (sucB)
Enzymes [BR:puv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PUV_12310 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391235..1392416
Genome map
AA seq 393 aa AA seqDB search
MKEEIKVPAMGESITEATVGTLIKPSGSTVQVDDEILELETDKVNQVLYAKASGVLTLQV
KPGETVTIGQVVGFVDTEAKATQGSASEPQATVPKTEEKAQAKPQEAPQPSQGIRYGKEA
FLEDVVKPEQKDFPQSVPVGKTREQEIPQLEEEAPPPKKMEGRETRRKMSQIRKVIANRL
VEAQQTTAMLTTFNEIDFSAIMAAREKYKDAFLKKHGVKLGFMSFFVKAVVSALREVPDL
NSYIDGNEIVHREYFDIGIAVGTDRGLIVPVLRNCEQLSFAEVEKDIEAYAKKAREGRLA
VDDLQGGGFTITNGGIYGSLLSTPILNPPQCGILGMHKIEKRAVVVDDQIVIRPMMYVAL
SYDHRIVDGKEAVTFLVHVKNALEDPSRLLIEV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaaatcaaagtccctgcaatgggagaatcgattactgaagcaactgtggga
accttaatcaaaccgtctggttcaacagttcaagttgatgatgaaattttggaattggaa
actgacaaggtcaatcaggttctttatgctaaagcatctggagtgttaactttgcaggtc
aaaccaggagagacagttacaattggtcaggtcgtcggctttgtagatacagaagcaaaa
gcaacacaaggctcagcgtcagaacctcaagctactgttccaaaaaccgaagaaaaagct
caagccaaaccgcaagaagctccacagccttcacagggcattcggtatggaaaagaggcg
tttttagaggatgtggtaaaacctgaacaaaaagattttccacaatctgtgcctgtggga
aaaacacgtgaacaagaaattccacagctagaagaagaggctccccctcctaaaaaaatg
gaagggcgcgaaacgcgacgtaaaatgtctcagatacgcaaagtgattgcgaatcgattg
gtagaagctcaacaaaccacagccatgctaacaacctttaatgagatcgatttttcagct
atcatggctgctcgagagaaatacaaagatgcttttctaaaaaaacatggtgtgaaatta
ggctttatgtctttttttgttaaggctgtggtatctgctctaagagaagtccccgatttg
aattcctatattgatggaaatgagatcgtccatcgcgaatattttgatattggaattgcg
gtcggaacagatcgtggcttaatcgtgcccgttttacgtaattgtgaacaactttctttt
gcagaagttgaaaaagatatcgaagcttatgccaaaaaagcccgcgaaggtcgactcgct
gtggatgatttgcaagggggaggttttactattaccaatggcgggatttatggttctctt
ctctccacgcctatcctcaatcctccgcagtgtggcattttagggatgcataaaatagaa
aaaagagcggttgttgtggatgatcagattgtgattcggcccatgatgtatgtagcttta
agctatgatcatcgcatcgtcgatggaaaagaagccgtgacctttttagtgcatgtcaaa
aatgccttggaagatccctcaagactattaattgaggtgtaa

DBGET integrated database retrieval system