KEGG   Parachlamydia acanthamoebae: PUV_14580Help
Entry
PUV_14580         CDS       T01552                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:puv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:puv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:puv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:puv00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:puv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640307..1642292
Genome map
AA seq 661 aa AA seqDB search
MPNSDIPSLENLMEEKRFFPPSPEFQKKAWIKNAKEYKALYQRSLKDPDSFWLEQAKSLT
WSKQPKHAGKHIWDSDRRLVEHSWFEDGKLNVSVNCLDRHLETETSDKIAILWQGEADEE
VRQITYKELHQEVCQFASILKQKGVQKGDRVCLYLPMIPELAVAMLACARIGAIHSVIFG
GFSAEAIIHRINDATCECVVTSNVSLRGGKEIFLKSTMDKALELCPTVKQVIVVKRNETA
CVMKEGRDSWYHDEMRSASADCPPVTLNAEDPLFILYTSGSTGKPKGVVHTQAGYLLFAA
MTHRYVFNIHEDDVYWCTADIGWVTGHSYVVYGPLANGSTSLMFEGIPTYPDAGRFWQVI
DKHKVTVFYTSPTAIRTLISHGQEFPKKYSLASLRVLGTVGEPINPESWMWFYENIGREK
CPIEDTWWQTETGGIMITPFPACFSIKPGSAGRPFFGIDPIILRPDGTPCDKHEGGSLCI
QKPWPGIMRTAWGNHDRFINTYFTTFKNVYFTGDGCHIDSDGDYWLLGRLDDVVNISGHR
IGTAEVESALTSFPSVAEAAVVPFPHTIKGQGLEAFVTLVEGISPTDSLKQFLRDHVKQV
IGAIAVPERIHFAKALPKTRSGKIMRRILRKIAENELDSLGDISTLSDPQVIQDLLKNRE
I
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcctaattcagatattccctctctcgaaaatttaatggaggaaaaacgttttttcccc
ccatcaccagagtttcagaaaaaagcctggataaagaatgcgaaagaatataaagcgctc
taccaaagatctttaaaggatcccgattcattctggcttgagcaagcaaagtctctcaca
tggtcaaaacagccaaaacatgcgggaaagcatatttgggattctgatcgccgcctggtt
gagcattcctggttcgaagatgggaaacttaacgtgagtgtgaattgcttagatcgacat
ttggaaacagagacgtctgataaaatagcaattctttggcaaggtgaagctgacgaggaa
gttcgccaaatcacctacaaagagcttcatcaagaagtttgccaatttgcctctattctt
aaacaaaagggtgtccaaaaaggtgatcgagtttgcctgtatttaccgatgatcccagaa
ttggctgtcgccatgcttgcatgcgcacgtattggagcaatccactctgttatttttggt
ggatttagcgcagaagcgattatccaccggatcaatgatgccacatgtgaatgtgttgtc
acctcaaatgtttccctgcgaggaggcaaagaaatttttctgaaaagtaccatggataag
gctttagagttatgtccaactgttaagcaggtcattgtcgtgaaaagaaatgaaactgct
tgtgtcatgaaagaaggacgcgatagctggtatcatgacgaaatgagatctgcttctgct
gattgccctcccgtaactttaaatgcagaagatcctctattcattttatatacgtctggg
tctactggaaagcctaaaggtgtggtgcatacacaagcagggtacctcctctttgcagct
atgacacatcgttatgtctttaatattcacgaggatgatgtctactggtgcacagcagac
attggttgggtgacaggtcatagctatgtcgtgtatggtccactagcaaatggatctaca
tcgcttatgttcgaaggaatccctacctacccggatgctggcagattttggcaagtgatt
gataaacataaagtgactgttttttacacctctccgacggccatccgtactttaatcagt
cacgggcaagaattccctaaaaaatattcattggcttctttgcgtgtacttggaactgtt
ggggaaccgatcaatccagaatcttggatgtggttttacgaaaatattggccgcgaaaaa
tgccccatcgaagacacctggtggcagaccgaaacgggaggaatcatgattacccccttt
cctgcatgttttagcataaagccgggaagtgcaggacgccccttttttgggattgatccg
attattctgcgtcccgacggcacaccatgtgataaacatgagggagggagcttgtgcatt
caaaaaccatggccgggaatcatgcgaaccgcctggggaaatcacgaccgtttcattaat
acgtattttacgacttttaaaaatgtctattttactggagatggctgtcatatagattcg
gatggcgactactggttactcggccggctagatgacgtggtgaacatatcagggcaccgg
attggaacagcagaagtagaaagtgccctcacaagctttccctctgttgccgaagctgcg
gtggttccatttccacatacgattaaaggtcaaggtttagaagcttttgtcacattggtt
gaaggaatctctcctacagattcccttaaacaatttctgcgcgatcatgtcaagcaagtg
attggggcaattgcagttccggaacggatccattttgccaaagctcttccaaaaacacgc
tcaggaaaaatcatgcgacgcatcctccgcaaaattgcggaaaatgaattggatagctta
ggcgatatctcaacactatcagatccccaagtgattcaagatttattgaagaatcgggag
atctag

DBGET integrated database retrieval system