KEGG   Parachlamydia acanthamoebae: PUV_14730Help
Entry
PUV_14730         CDS       T01552                                 

Definition
(GenBank) putative uncharacterized protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00010  Glycolysis / Gluconeogenesis
puv00052  Galactose metabolism
puv00500  Starch and sucrose metabolism
puv00520  Amino sugar and nucleotide sugar metabolism
puv00521  Streptomycin biosynthesis
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_14730
   00052 Galactose metabolism
    PUV_14730
   00500 Starch and sucrose metabolism
    PUV_14730
   00520 Amino sugar and nucleotide sugar metabolism
    PUV_14730
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PUV_14730
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PUV_14730
Enzymes [BR:puv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PUV_14730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N Glucokinase FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: CCB86423
UniProt: F8KZR7
Position
1659776..1660771
Genome map
AA seq 331 aa AA seqDB search
MTFKKWTIGIDVGGTKIETALVNADGTILFRSKTHTKAKDGLDAIIHQIGKVIQDLQKQT
SDSIAGIGIGIPGQIDPASATILSTPNLPFKNTPLKKRLESFTSLPIYIDNDVRTATRGE
WIFGAGKGCANFVCMFLGTGVGGGIVINNQIFSGNSYTAGEIGHMTVELNGPLCTCGNYG
CVEAFSGGWAISKRAQTKLKKHGKLTPLLELAQGNVDKIDAALVFEAMKLHDPIAIEVVS
DAANALSACASSIVNALNPKRLIIGGGILSGYPHFLEEIRAGIQTRALAASTQRLEVVAT
ATQGNASLLGAAVLVLESQFPNLIHEEKIKC
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaaaaaatggacaattggaatcgacgttggtggaacaaaaattgaaacggct
ttagtaaatgcagatggcaccatcctttttcgctcaaaaacgcacacaaaagcaaaagat
ggtttagatgctattattcatcaaattggaaaagtcattcaagaccttcagaagcaaacg
agcgattcaattgcggggattggcattgggattccgggacaaattgacccagcctcagct
acaattctctcaacccctaacctcccttttaaaaacacaccactaaagaaacgtttagaa
agtttcacatccctgcctatttatatagataatgacgtacgcaccgcgacaagaggcgaa
tggatttttggagccggaaaaggatgcgccaattttgtttgcatgtttttgggaactggc
gtcggtggtggaattgtgatcaacaatcagatcttttcgggtaattcctatacagccgga
gaaatcggacatatgacggttgagttgaatggtcctctttgcacatgtggaaattatgga
tgcgtggaagcttttagcggcggatgggcaatttccaaaagagcgcaaacaaaattaaaa
aaacacggaaaactgacgccgcttttggaactagcccaaggaaatgtcgataaaatcgac
gctgctctagtttttgaggcgatgaagctgcatgatcctatcgcaatcgaagtggttagc
gatgcggccaacgcgctttctgcctgcgcaagctctatcgtgaatgccttaaacccgaaa
cgcctcattatcggcggaggaattttatctggataccctcattttcttgaagaaatccga
gccgggatccaaacgcgcgcgcttgccgcctccactcaaagattagaggttgtcgcaact
gccacacaaggaaacgcgtcacttcttggagctgctgtccttgtgcttgaaagccaattc
ccaaacttgattcatgaagagaaaataaagtgttga

DBGET integrated database retrieval system