KEGG   Parachlamydia acanthamoebae: PUV_16710Help
Entry
PUV_16710         CDS       T01552                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUV_16710 (glgB)
Enzymes [BR:puv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PUV_16710 (glgB)
Exosome [BR:puv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PUV_16710 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1877487..1879655
Genome map
AA seq 722 aa AA seqDB search
METHTSPLTHTQFDSLLAGEAFDPHQFLGLHQASEDQQVIRLWRPGAKEIHLKIQDQIIP
AVQIHQAGLFELKVPNTLQQTDYEVFHQNGLSGSDPYTFAPTIGEVDQYLFSKGVHYKLY
QIMGARLAEHQGHKGTKFAVWAPSARSVSVVGDFNHWDGRTNPMRVLGQSGIWEIFIPGI
GEGEKYKFEIRTQSGELKIKADPFAFRSELRPATASMVTDVDRFQWEDQQWMEQRILKRN
DPKPLNVYEVHLGSWKTKNGYFLNYRELAVELARYCQEMGYTHVELLPIQEHPLDESWGY
QVSGFYAVTSRFGTPEDFQWFVNHLHMHQIGVILDWVPGHFPTDDFSLGNFDGTSLYEHA
DPRQGFHPHWHTHIFNFGRHEVSNFLIANALFWFDKMHVDGLRVDAVASMLYLDYGREPQ
QWIPNQYGGKENLDAIEFLKHLNSIVHKFFPGVYTIAEESTAFPAVTYPVEQNGLGFDFK
WNMGWMNDTLRYFSKDMLFRSHHHHDLTFGLLYAFTEKFVLVLSHDEVVHGKNSLLGKMP
GDLWQKFANLRLLFSYTMCQPGKKLFFMGAEIGQWNEWSCKKEVEWDLLRYPSHQGIQTM
VKELNHFYLSSRELWEKDLDHTGFEWVDFNDTKNSVICYLRKSSQGALLCIHNFTPAYHS
DYFIHLQNISWITECFNTDHEKYGGSGKRNLNPHVHVDSHGKKVGVSIQLAPLATMIFQI
GF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcacacatctccccttacccacactcaatttgattcattacttgctggagaa
gcctttgatccccaccaatttttaggactacaccaagcttcagaggatcaacaagtcatt
cgattgtggagaccaggtgcaaaggaaatccatttaaaaattcaagatcaaatcattcca
gccgtacagatccaccaagctggtctttttgaattaaaagtgccaaataccctccaacaa
acagattatgaagtctttcaccaaaatggattaagcggcagcgatccctacacttttgca
ccaaccattggcgaagtggatcaatacctttttagcaaaggagttcactataaactctac
caaattatgggcgctcgtttggccgagcatcaaggacataaaggtaccaaatttgcggtg
tgggcaccatctgcccgctctgtatctgttgtaggagactttaatcattgggatggtcga
accaatccgatgcgcgttttgggtcaatcaggaatttgggagatttttatccctggaatt
ggagaaggagaaaagtataaattcgaaatacgtactcaatccggagagctgaaaattaaa
gcggatccttttgcttttaggagtgagttacgtcccgcaacagcctctatggttaccgat
gtggatcgctttcaatgggaagatcaacaatggatggaacaacgcattctgaaaagaaat
gatccaaaacccctcaatgtgtatgaagtccatttgggatcatggaaaacaaaaaatggc
tattttctcaattatcgagaattagctgttgaactcgcgcgttattgccaagaaatgggt
tatacgcatgtcgaacttttgcccattcaagaacaccccttagatgaatcctggggatat
caagtctccggcttttatgctgtgacaagccgttttggaacaccagaagactttcaatgg
tttgtcaatcatctccacatgcatcaaatcggtgtcattctcgattgggtcccaggccat
tttccaaccgatgatttttctctgggaaattttgatggcacctctctctatgagcatgcc
gatcctcgacaaggctttcatccccactggcacacccacatattcaattttggccgacat
gaagtatctaatttcttaattgctaatgccctattttggttcgacaaaatgcacgttgat
ggactacgcgttgatgccgtggcctccatgctttatttagattatggacgcgaaccgcaa
caatggattccaaaccaatacggtggaaaagaaaatctcgacgccatcgaatttctcaaa
cacttaaattctattgttcataaatttttccctggcgtttataccatcgctgaagaatcc
accgctttccctgcagtcacctatcccgttgaacaaaatggactcggctttgatttcaag
tggaatatgggatggatgaatgatactcttcgctacttttctaaagacatgcttttcaga
agtcaccatcaccatgacctcacttttgggcttttatacgcgttcactgaaaaatttgtt
ttggttttatctcatgatgaagtggtacatggaaaaaatagcctgctggggaaaatgccc
ggcgatctttggcaaaaatttgccaatttacgtctattattcagttataccatgtgtcaa
cccggcaaaaagttatttttcatgggtgccgaaatcggtcaatggaacgaatggtcttgc
aaaaaggaagtcgaatgggatctccttcggtacccttctcatcaaggaatccaaacaatg
gtaaaagagctcaaccacttttatctttcttcgcgagaattatgggaaaaagatctcgac
cataccggctttgaatgggtcgactttaatgatacgaaaaatagcgtgatttgttatttg
cgtaaaagtagccaaggcgcgctgctgtgcatacataattttacaccggcctatcattcc
gattactttatccacctacaaaacatcagctggataacagaatgctttaatacagatcat
gaaaaatatgggggatcgggaaagcgtaatcttaatccacatgttcacgttgactcacac
ggaaaaaaagttggagttagtattcagcttgctcccttggcaaccatgatttttcaaatt
ggattttag

DBGET integrated database retrieval system