KEGG   Parachlamydia acanthamoebae: PUV_17360Help
Entry
PUV_17360         CDS       T01552                                 

Gene name
chrC
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
puv  Parachlamydia acanthamoebae
Brite
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PUV_17360 (chrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1948607..1949284)
Genome map
AA seq 225 aa AA seqDB search
MKKIWLVAICLMMGVAQMAMGDETASSTKKYEVRDFDHLLGKVKGLNDDLLKMHFKLYQG
YVNNTNTLLQKIGELDQTGKSQSPEFAGFKHMLGWEFDGMLLHEYYFENLGGQTHQLKQD
DPLFLKMVQDFGGYDQWKSDFQATGAIRGIGWVITYVDPKQGRLVNTWINEHDVGHLSGG
KPLLVMDVFEHAYITQFGLDRAKYIQVFFDNIDWNAVSQRYKKTL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatttggctagtagcaatctgcttgatgatgggcgttgctcagatggcaatg
ggtgacgaaactgcgtcatcgacaaaaaaatatgaagtacgtgattttgatcatttgctt
ggaaaagtgaagggattaaatgatgacttattaaagatgcatttcaaattgtatcaaggt
tatgtcaacaataccaatacactcttacaaaaaataggggagcttgaccagacaggcaaa
agtcaaagccccgaattcgctggttttaagcatatgttaggatgggaatttgatggaatg
ttgttgcatgagtactactttgaaaatttaggcgggcaaacccaccaattaaaacaagat
gacccactatttttaaagatggtgcaggattttggtggatatgaccaatggaaatccgat
tttcaagcaaccggtgccattagagggattggctgggtcattacatatgtggatccaaag
caaggaaggctagtaaatacgtggattaatgagcacgacgtcggccacctgtcgggagga
aaacctttactcgtgatggacgtatttgaacatgcttacattacgcaatttggattggat
agagctaaatatatccaggtattctttgataatattgattggaatgccgtttctcaaaga
tataagaagacgctttaa

DBGET integrated database retrieval system