KEGG   Parachlamydia acanthamoebae: PUV_17370Help
Entry
PUV_17370         CDS       T01552                                 

Gene name
mauG
Definition
methylamine utilization protein MauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
puv  Parachlamydia acanthamoebae
Brite
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PUV_17370 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949376..1950461
Genome map
AA seq 361 aa AA seqDB search
MKRFSYTFFGILTFLGLLWITFEGLQYLRAKRSEMTSLSAQEQEPFAVPLGLPPLPWPED
NPYNKEKAELGRLLYFDKRLSSNGTVSCATCHAIQDAFTDNQVVSQGIDGNKGNRNSPTV
INSAYQDFLFWDGRASSLEDQCKGPLANRKEMTQAQSASDAHRECQERIQKIAGYRALFK
SVYGNDDCSIDDIAKAIATFERTILSGNSPYDRYIVNKDKTAMSAEAIQGLTVFKRSGCA
NCHAEPLFTNGQFTNIGVGMDVKDPDLGRYEITHNKMDLGAFKVPTLRDVERTFPYMHDG
SLKTLEEVVEYYNKGGIPNSNLHPLIKPLNLSESDKQALVKFLQSLNGEGWQIKEPEKFP
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattttcttatacattctttggtattctgacttttttaggattactttggatc
acttttgaaggtttgcaataccttagagccaaacgttctgagatgacctcgctatcagcc
caagaacaagagccctttgcagttccattgggcttacctccactaccttggcctgaggat
aacccttataacaaagaaaaagcggaattaggacgccttctctattttgataaacgcctt
tcctccaatggaaccgtctcctgtgctacttgtcatgctattcaagatgcttttacagat
aatcaagttgtttctcaaggcattgatggaaacaaaggaaaccgaaactcccctacagtc
attaactcagcataccaagattttctattctgggatggaagagccagttctctcgaagat
caatgcaaaggtcccttagctaatcgaaaagaaatgactcaggcacaaagcgcttcggat
gcacaccgagaatgtcaagaacggattcagaaaattgcaggctaccgagctctatttaaa
tcggtgtatggaaatgacgactgcagcattgatgatatagcaaaagcaatcgccactttt
gaaagaaccattctttcaggaaactccccttatgaccgctacatcgtcaataaagataaa
accgccatgtctgccgaagcgattcaagggttaaccgtatttaaacgcagtggatgtgca
aattgccacgcagagcccctttttacgaatggtcaattcacaaatatcggtgttggaatg
gatgtcaaagatcctgatctcggtcgctatgaaattacccataacaaaatggatttggga
gcgtttaaagttcccactttgcgagatgtggagcgcacatttccctatatgcacgatgga
agcttaaaaaccttagaagaagtggttgaatattataacaagggtggaattcctaactct
aatttacatcccctcatcaaacctctcaatctgagcgaaagtgataaacaagcacttgtg
aaatttttgcaatcactcaatggagaaggttggcagattaaagaaccggaaaaatttcct
gattaa

DBGET integrated database retrieval system