KEGG   Parachlamydia acanthamoebae: PUV_18050Help
Entry
PUV_18050         CDS       T01552                                 

Gene name
yrrC
Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:puv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003452..2005635)
Genome map
AA seq 727 aa AA seqDB search
MQQIVTGYIERITFQNPETGYTVAQLKEAKRTDLVCVVGIMPTLQPGETVRCWGQWKRHL
IHGNQFEVERYQVEAPADILGITKYLGSGLIKGIGPKYAARIVEKFGTETLDMIDRFPNR
LSEIPGLGAKRIETIKTCWAEQKSIRDVMIFLQAHGVSPTYAQKIFKAYGTHSIAKVKEN
PFHLARDIFGIGFKTADLIAQKLGIDSKSSIRTDAGVEFVLSELASDGNVCYPVDLFIEE
ANKVLEIEQEKISERISVLKEQGRVEHFKLIHAGEPLQFIWLKPLFVAEVGIAREIQRLL
SAPVVLRDVDVDKALQWIQAEHCIDLAVNQKEAVAQALFQKMHIITGGPGTGKSTITKAI
LGITEKLTSKILLAAPTGRAAKRMSEITGKKASTIHSLLEYDFKGKGFKRNRSSPLVCDL
LIIDESSMIDTFLMYSLLKAIPDNARVIFVGDINQLPSVGPGNVLQDLIASQVVSVTTLN
EIFRQAAGSFIITNAHRINRGMFPDIRNLSQSDFFFVEAQETEDVLKQIVALVSQRLPKK
YDFHPSDDIQVLAPMKKGNIGIDNLNAVLQETLNPNQTPLMRQGRKLMVNDKVMQIRNNY
SKEVFNGDIGRIVDIDHVEQQVVVKVEEREICYEFSELDEIVLAYAVSIHKYQGSECPCV
VIPVHTSHFKLLYRNLLYTAVTRGKKLVVLVGTKKALSIAVRNDEIKKRYTGLKQALVEL
NTAVSSI
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaattgtaacaggatatattgaacggattacttttcaaaatccagaaaccggc
tatactgtggcccagcttaaagaagcaaagcgtacggatttagtttgtgtcgtgggcatt
atgccaaccctacaaccaggagagacagttcgttgctgggggcaatggaaaaggcattta
atccatggcaatcaatttgaagttgagcgttatcaagtagaagctcctgcggatatttta
ggtattacaaaatacttgggatcggggttgattaaagggattggtccaaaatatgctgct
cggattgtggagaaatttgggactgaaacgttagacatgatcgaccgtttcccgaacagg
ctttcagaaataccggggcttggtgcgaagcggatagaaacaattaaaacatgctgggcg
gagcaaaaatccattcgggatgtcatgatttttttgcaagctcatggcgtaagtcccact
tatgctcaaaaaattttcaaagcctatggcacccacagcattgcaaaagttaaagagaat
ccttttcatcttgctcgagacatttttggaattggctttaaaaccgccgacttaattgct
caaaaactagggattgattccaagtcgagcattcgtacagatgcaggygtcgaatttgtt
ctttctgagcttgccagcgacgggaatgtctgctatccggtcgatctatttattgaagaa
gccaataaagtattggaaatagagcaggagaagatctccgaaagaatttctgtattaaaa
gagcagggacgtgttgagcattttaaattgattcatgctggagaacctttacaatttatt
tggttaaaacctttatttgttgctgaagtggggattgcgcgcgagattcaacgattgttg
tctgctccggttgttttgagagacgttgatgtcgataaagccttacagtggattcaagcg
gagcattgcatcgatctagcagtcaatcagaaggaagctgttgctcaagctttattccaa
aagatgcatattattacaggtggaccaggaacaggaaaaagcaccattacaaaagctatc
ctaggtatcacggaaaaattgacttctaaaattcttctggctgctcccacaggcagggca
gctaagcgcatgagtgaaattacaggcaaaaaggcttcaaccatccatagcttgcttgaa
tatgatttcaaaggaaaaggatttaagcgtaatcgttcttctcccctggtgtgtgactta
ttgatcatcgatgaatctagcatgattgatacctttttgatgtacagcttgcttaaagcg
attcctgacaacgctcgtgtgatttttgtgggagatattaatcagctgccgagcgtggga
ccagggaacgtattgcaagacttaattgcttcccaagtggtgagtgtaaccacgcttaat
gaaatttttcgacaggctgcgggatcctttattattacaaatgcgcatcgaattaaccgc
ggaatgttccccgatattcgcaatctcagtcaaagtgattttttctttgtagaagcacag
gaaacagaagatgttttaaaacaaattgtggccttagtctctcaacgtctgcccaaaaaa
tatgattttcatccctcggatgatattcaagttttagcccctatgaaaaaagggaatata
ggcatcgacaatttaaatgccgttctacaagaaaccttaaatccaaatcagactccttta
atgcgtcagggtcgtaagctaatggtcaatgataaggtgatgcaaattcgcaataattac
tcaaaggaagtctttaatggggatattggacgcattgtggatattgaccatgtcgaacaa
caagttgtagtaaaagttgaagagcgtgagatttgttatgaattttccgaattagatgaa
attgttttagcttatgccgtttccatacataaatatcaaggaagtgaatgtccctgtgtg
gtgatccctgtgcataccagtcattttaagcttttatatcgaaatcttctttatacagct
gtgacgcgaggaaaaaaacttgtcgttttggtcgggacaaaaaaagctttatccatcgct
gtgcgcaatgatgaaatcaaaaaacggtatacgggtcttaaacaagctttagtggaatta
aacactgcagtttcgtcgatatga

DBGET integrated database retrieval system