KEGG   Parachlamydia acanthamoebae: PUV_18540Help
Entry
PUV_18540         CDS       T01552                                 

Definition
hypothetical protein
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
puv  Parachlamydia acanthamoebae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2048869..2050293)
Genome map
AA seq 474 aa AA seqDB search
MAKVTIVWMRQDLRIEDHPALDAAAQRGSVIPLYIWSPQEEGHWPLGGASKWWLHHSLKS
LENDLRSLGLPLIIRKGKSLDCLRDVIKETNADAVFWSRRYEPYAIKRDIQVKSKLSEEG
LLAKSFPGNVLYEPWSIQNKQGKPFQVFTFFWKNCLAKEQPLAPLSAPIGVKGKIVEVDS
LHIEDLKLLPTTSWDEGIAHTWKPGSVYAKEFLSYFLEGGAHDYNERRDRPDLPGVSRLS
PYLHFGEISVRMVWDEIVKKLGFQEAEPYLRQLGWRDFAYHLLYHFPKTPEEPLRQEFAY
FPWKENKKLLKVWQKGMTGYPFVDAGMRQLWMTGWMHNRARMVVGSFLVKDLLLPWQTGA
QWFWDTLVDADLANNTLGWQWVAGSGADAAPYFRIFNPITQGEKFDPEGSYVRKWVPEIA
NLPDKWIHKPWEAPLDVLEKAGVKLGQTYPYPIVNHDEARLAALEAFEEIKAAR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtcaccatcgtatggatgcgtcaagatttgcgcattgaagatcatccggcc
ctagacgctgcagcacaaagaggaagtgtcattcctctttacatttggtctcctcaagaa
gaagggcattggcctttgggtggagcgagcaagtggtggctgcatcattctttaaagtct
ttagaaaatgatctacgatccttaggtttacccctgatcattcgtaaagggaaaagccta
gattgtttgcgcgatgtgattaaggaaacgaatgccgatgccgtattctggtcacggcgc
tatgagccttatgccattaaaagggacatccaggttaaatcaaagctttcggaagaaggc
cttttagctaaaagttttccgggaaatgtattgtacgaaccttggagcattcaaaataag
caagggaagccttttcaggttttcacttttttttggaaaaattgtttggctaaagaacag
ccgcttgctccattgtcggcacccattggtgtgaaaggaaagattgttgaggtcgattct
ctccatatcgaagatttaaaattgctcccaacaacttcttgggatgaggggattgcccat
acctggaagcctggaagtgtgtatgctaaagaatttttgtcatactttcttgaaggggga
gcacatgattacaatgaaaggcgggatcgccccgatttgcccggggtgtctcgtttgtcg
ccctatctgcattttggtgaaataagtgtcagaatggtttgggatgaaattgtgaaaaag
cttggattccaagaagccgaaccctatttaaggcagctcggttggcgtgattttgcttac
catttgctctaccattttcctaaaaccccagaagagcctttacgacaagagtttgcctat
tttccctggaaagaaaataaaaaactgttgaaagtctggcaaaaaggaatgacaggttat
ccctttgttgatgcgggaatgcggcagctgtggatgactggttggatgcacaatcgagca
cgcatggtggtggggtcttttttggtaaaagacttgcttcttccttggcaaacaggggca
caatggttttgggatacccttgtggatgccgatctagcgaataatactttaggctggcaa
tgggttgcaggttcgggagctgatgccgctccctatttccgcatattcaatcctattacg
caaggagagaaattcgatcctgaaggtagctatgtgagaaaatgggtccctgaaattgct
aatcttcctgataaatggattcataaaccctgggaagcacctctagatgtactagaaaaa
gcaggtgttaagcttggacaaacctatccatatcccattgttaatcatgatgaagctcgc
ttggcagcgttagaagcttttgaagaaatcaaagcggctcgataa

DBGET integrated database retrieval system