KEGG   Parachlamydia acanthamoebae: PUV_19070Help
Entry
PUV_19070         CDS       T01552                                 

Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
puv  Parachlamydia acanthamoebae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2098917..2099435
Genome map
AA seq 172 aa AA seqDB search
MKQLSFILLTALAFCWLSSAQAATATSQIHWHENYADAAKLSASTGKPIFLLFTGSDWCT
YCIKLENEVFATPEFSQDLANRLIFVKLDYPPKASVPPQIKEQNEALKRKFNIQGFPTVI
LLDSKGGQIGVTGYKTGGGKSYADHIQKLLNNHSAYLQKMNTAESQKLSKAA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattatcttttatattgttaacagctctcgctttctgctggctaagctcggca
caagccgctacagcaacttctcaaatccattggcatgaaaattatgcagatgcagctaaa
ttatccgcatctactggtaagccaatatttttgctattcacaggatcagattggtgtacg
tattgcattaaattagaaaacgaagtgtttgctaccccagaattttcgcaagatttagcg
aatcgtttaattttcgttaaacttgattatcccccaaaagcatccgttcccccacaaatc
aaagaacaaaacgaagctttaaaacgcaaattcaatatccaaggctttccaactgtgatt
cttttagattctaaaggtggccaaattggggtaacaggctataaaacaggtggcggtaaa
agctatgctgaccatattcaaaaattgctgaataatcattccgcttatttacaaaaaatg
aatactgctgaaagccaaaaactttcaaaagcagcttag

DBGET integrated database retrieval system