KEGG   Parachlamydia acanthamoebae: PUV_19710Help
Entry
PUV_19710         CDS       T01552                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelateligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:puv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:puv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2171372..2172853
Genome map
AA seq 493 aa AA seqDB search
MKLKKVLKDIPVVQVKGSKEIEISGICANSQLIAPGNLFIAKKGLKFDGTSYIPEAINHG
ATAIVTDIYDPSFKEITQIICKNVAEVEGRFSANFYQMPSQELFTVGITGTNGKTTTSFL
VKYLLEQLNLPCGLIGTIEYILGRYRYKASHTTPDVHSNHHMLREMVHQGCQAAVMEVTS
HALDQKRVEHIDYDIAIYTNLTQDHLDYHQNMECYAAAKRKLFLQLDQVPSKKSKQIIAN
LDCPWFETILKGIKTPIFTFGIDSPADLRACPTSFGPTGTHIDLHYQGRSYSTFFPLIGR
FNIYNCLAAIAVGLTRKITLEKLISLAQQFPPPPGRLEPIQNDLDLNLFVDFAHTEDALY
KALECLSELKKGKIITVFGCGGDRDKTKRPKMAQASASFSDLTIVTSDNPRSEDPLKIIQ
EIAEGFSLQDNYIVQPDRFSAIAFAIEKANPGDIILVAGKGHETTQIFAHHTIEFDDRKI
AQEICAKMSLNTY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaaaaagtcctcaaagacattcctgttgtgcaagttaaaggctcaaaagaa
attgaaatatctggcatatgtgcaaattctcaattaattgctccaggaaatttatttatc
gcaaaaaagggattaaaatttgatggcacttcatatattccagaagccattaaccatgga
gcaaccgcaattgtaacggatatttacgatccatcctttaaagaaatcacgcagattatc
tgcaaaaatgttgcggaggtagaagggcgtttttctgctaatttctaccaaatgccttcc
caagaactttttactgtcggtatcacaggaactaatggaaaaacaaccacatctttttta
gtgaagtatttgctcgaacagctcaacctcccctgcggcctcattggcaccatcgaatac
attcttggtaggtatcgttacaaagcctctcacacaacgcctgatgtacattccaatcat
cacatgctccgagaaatggttcatcaaggctgccaagctgccgtcatggaagtgacttct
cacgcacttgaccaaaaaagagtggaacacatcgattatgatatcgccatttacacaaac
ttgacgcaggatcatttagattaccatcaaaatatggaatgctatgcggcagcaaaacga
aaactctttttgcagctcgatcaagtcccatctaagaaaagcaaacaaattattgcaaat
cttgattgcccttggtttgaaaccattttaaaagggattaaaacccctatttttacattt
ggaattgacagccctgctgatttacgtgcctgccccacatcttttggaccgactggaaca
catattgatctacattatcagggacgcagctattccactttttttcctctcatcggacga
tttaatatttacaattgcttagctgctattgcggtagggcttacacgcaaaattacacta
gaaaaattgatctctctagctcaacaatttccgccccctcctggtcgattggagcctatt
caaaatgacctagatttaaatctttttgttgattttgcacatactgaagatgctttatac
aaagccctggaatgcttatctgaactcaaaaaagggaaaatcatcactgtttttggatgt
ggtggagatcgagataaaacaaaaaggcctaaaatggctcaggcaagtgcatctttttct
gacctaactatcgtaacttcggataatcctcgttcagaagatcctctaaaaatcattcag
gaaattgctgaggggttctcccttcaagacaactatatcgttcaaccagatcgcttttct
gctatcgcctttgcgatcgaaaaagcaaatccgggtgacatcattttggttgcaggaaag
ggacatgaaacaacacaaatttttgctcatcatacaatcgaatttgacgatcggaaaatt
gctcaagaaatctgtgccaaaatgtctcttaacacttattaa

DBGET integrated database retrieval system