KEGG   Parachlamydia acanthamoebae: PUV_19780Help
Entry
PUV_19780         CDS       T01552                                 

Gene name
cheB
Definition
chemotaxis response regulator CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:puv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2184366..2185406)
Genome map
AA seq 346 aa AA seqDB search
MRIGIAYGDERIAQVLNRLILNHSDHEVVWIACSSTQVFEKAIDEKPDLILLDLNIPSTG
GVEATRRMMKQAPCALLLLVQSVNWRSAEIFEAMGYGALDVLAMQTSIGEIEKEALLKKI
ETIGLLIGHHYNRKKSGINIHGKKASRLPHLVLIGASTGGPLALAKLLADFPQHSSLAIV
AIQHVDEKFAAGFANWLDRQISLEVKIADQGTQPEEGFVLVAGTNHHLIMNQKLELVYAP
NPLDSPYRPSVDVLFNSVAEHWPNRGVAVLLTGMGSDGAKGLKRLHDLGWHTIAQREESC
VVYGMPKAAVDLAAVRETLQLEKIADSIKSYFNLNPVTRTKRGLYE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgggatcgcctatggggatgaacggatcgcacaggtgctgaatcgactcata
ttaaatcattcagatcatgaagtggtctggattgcttgctcttcgacccaagtctttgaa
aaagctatagatgaaaagccggatcttattcttttagatttaaacattccttctacgggt
ggcgtagaagccactcgtcgtatgatgaaacaggctccatgcgctcttttacttttagtt
caaagtgtgaattggcgttctgccgagatttttgaagcaatgggatatggtgctttggat
gttttagctatgcaaacttctattggagaaattgaaaaagaggccttactaaagaaaatt
gaaacgataggcctgttaattgggcatcattataatcgaaaaaagagtggcataaatata
catggcaaaaaagcgagtaggctccctcatttagttttaattggggcttcaacaggagga
ccattggcacttgctaaacttttagctgattttcctcaacattcttctctcgctatagtg
gctattcaacacgtagatgaaaagtttgccgccgggtttgcgaattggttagacaggcaa
atttctcttgaagtaaaaattgcggatcagggcactcaaccagaagaaggctttgtgtta
gttgcagggactaatcatcatctcattatgaatcaaaaattagagcttgtctatgctcca
aatccgcttgattctccctatcgaccatctgtcgatgttttgtttaatagtgttgctgaa
cactggcccaaccgaggagttgctgtattgttgactggaatgggctctgatggcgcaaaa
ggtttaaaacgtttgcatgatctagggtggcacacaattgcccagcgtgaagaaagctgt
gttgtttatggaatgcctaaagctgcggttgatctagcagctgtgagagagacgttgcaa
ctagaaaagattgctgattcgataaagtcttattttaatctcaatcctgtgacgagaacg
aagagaggattgtatgaataa

DBGET integrated database retrieval system