KEGG   Parachlamydia acanthamoebae: PUV_19940Help
Entry
PUV_19940         CDS       T01552                                 

Gene name
adh-B
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PUV_19940 (adh-B)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_19940 (adh-B)
  Lipid metabolism
   00071 Fatty acid degradation
    PUV_19940 (adh-B)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PUV_19940 (adh-B)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PUV_19940 (adh-B)
   00626 Naphthalene degradation
    PUV_19940 (adh-B)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PUV_19940 (adh-B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2202275..2203294)
Genome map
AA seq 339 aa AA seqDB search
MAKMRAIQVSRPNGPFEFVERDIPEPGEREVRIKVQACGICHSDSFTKEGTFPGVTYPRI
PGHEVAGIIDALGSKVKNWKVGERIGIGWYGGHCGYCESCRRGDFVTCSQLSISGVTYDG
GYADYMIASVDALALIPEELSPVEAGPLMCAGITTFNALKNSGARAGERVAILGVGGLGH
LAVQFSAKMGFHTIAIARGKDKEALAKRLGAHDYIDSLEKNPAKELVSFGGARVILSTIT
DAKAIESTLPGLSTNGKFIIVGIPHSPISITAGALISGRRSIAGWPSGTSIDSQDTMSFS
ALTGVRSMNEIYPFEKVEEAYEKMMSGKARFRVVLTTGH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgcgtgcaattcaagtcagtcgtccaaatggtccttttgagtttgttgag
cgagatattccagaaccgggtgaaagagaggttcgcattaaagtccaggcatgtgggatt
tgtcatagcgattctttcactaaagaaggcacatttccaggtgtgacttatccacgtatt
cccggtcatgaagttgctggtattattgatgctcttggttcgaaagttaaaaattggaag
gtgggtgaacgtatagggattggatggtatggagggcattgtggttactgtgagtcttgt
agaagaggcgattttgttacgtgcagtcagctttctatatctggtgtgacttatgatggg
ggatatgcagattatatgattgcttctgtggatgctttggccttaatcccggaggaactt
tcacctgtagaggctggtcctttaatgtgtgctgggattactacctttaatgcattaaag
aacagtggagcgcgtgcaggagagcgtgttgctattcttggtgttggtggtctagggcat
ttagcggttcaattttcggctaaaatgggatttcatactatcgcgatagcgcgaggaaaa
gacaaagaggctttagccaaaagattaggggcacatgattatattgatagtttagaaaaa
aatcccgctaaggagcttgtgagttttgggggagcgagggtaatcttatcgacgataacc
gatgctaaggcaatcgaatcaactcttccaggactcagcactaatggaaaattcatcatc
gtaggaatccctcatagtcctatttcaataactgctggagcgcttatttccggaagacgt
tctatcgcaggatggccctcaggtacttcgatagattctcaagatacaatgtcattcagt
gctctaacgggagtgcgctccatgaatgagatctatccctttgagaaggtagaagaagcc
tacgaaaaaatgatgagcggaaaagctcgtttccgagtagtcttaacaaccggacattaa

DBGET integrated database retrieval system