KEGG   Parachlamydia acanthamoebae: PUV_19940Help
Entry
PUV_19940         CDS       T01552                                 

Gene name
adh-B
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00010  Glycolysis / Gluconeogenesis
puv00071  Fatty acid degradation
puv00350  Tyrosine metabolism
puv00625  Chloroalkane and chloroalkene degradation
puv00626  Naphthalene degradation
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_19940 (adh-B)
  Lipid metabolism
   00071 Fatty acid degradation
    PUV_19940 (adh-B)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PUV_19940 (adh-B)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PUV_19940 (adh-B)
   00626 Naphthalene degradation
    PUV_19940 (adh-B)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PUV_19940 (adh-B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: CCB86944
UniProt: F8L125
Position
complement(2202275..2203294)
Genome map
AA seq 339 aa AA seqDB search
MAKMRAIQVSRPNGPFEFVERDIPEPGEREVRIKVQACGICHSDSFTKEGTFPGVTYPRI
PGHEVAGIIDALGSKVKNWKVGERIGIGWYGGHCGYCESCRRGDFVTCSQLSISGVTYDG
GYADYMIASVDALALIPEELSPVEAGPLMCAGITTFNALKNSGARAGERVAILGVGGLGH
LAVQFSAKMGFHTIAIARGKDKEALAKRLGAHDYIDSLEKNPAKELVSFGGARVILSTIT
DAKAIESTLPGLSTNGKFIIVGIPHSPISITAGALISGRRSIAGWPSGTSIDSQDTMSFS
ALTGVRSMNEIYPFEKVEEAYEKMMSGKARFRVVLTTGH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgcgtgcaattcaagtcagtcgtccaaatggtccttttgagtttgttgag
cgagatattccagaaccgggtgaaagagaggttcgcattaaagtccaggcatgtgggatt
tgtcatagcgattctttcactaaagaaggcacatttccaggtgtgacttatccacgtatt
cccggtcatgaagttgctggtattattgatgctcttggttcgaaagttaaaaattggaag
gtgggtgaacgtatagggattggatggtatggagggcattgtggttactgtgagtcttgt
agaagaggcgattttgttacgtgcagtcagctttctatatctggtgtgacttatgatggg
ggatatgcagattatatgattgcttctgtggatgctttggccttaatcccggaggaactt
tcacctgtagaggctggtcctttaatgtgtgctgggattactacctttaatgcattaaag
aacagtggagcgcgtgcaggagagcgtgttgctattcttggtgttggtggtctagggcat
ttagcggttcaattttcggctaaaatgggatttcatactatcgcgatagcgcgaggaaaa
gacaaagaggctttagccaaaagattaggggcacatgattatattgatagtttagaaaaa
aatcccgctaaggagcttgtgagttttgggggagcgagggtaatcttatcgacgataacc
gatgctaaggcaatcgaatcaactcttccaggactcagcactaatggaaaattcatcatc
gtaggaatccctcatagtcctatttcaataactgctggagcgcttatttccggaagacgt
tctatcgcaggatggccctcaggtacttcgatagattctcaagatacaatgtcattcagt
gctctaacgggagtgcgctccatgaatgagatctatccctttgagaaggtagaagaagcc
tacgaaaaaatgatgagcggaaaagctcgtttccgagtagtcttaacaaccggacattaa

DBGET integrated database retrieval system