KEGG   Parachlamydia acanthamoebae: PUV_19950Help
Entry
PUV_19950         CDS       T01552                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyLLysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00010  Glycolysis / Gluconeogenesis
puv00020  Citrate cycle (TCA cycle)
puv00620  Pyruvate metabolism
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01200  Carbon metabolism
Module
puv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_19950 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PUV_19950 (pdhC)
   00620 Pyruvate metabolism
    PUV_19950 (pdhC)
Enzymes [BR:puv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PUV_19950 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCB86945
UniProt: F8L126
Position
complement(2203396..2204688)
Genome map
AA seq 430 aa AA seqDB search
MPFTLTMPKLSPTMEEGMIVKWHKKEGDRVNANDVLLEVATDKATVEHGALDEGWLRKII
VKEGGEAKVNQPIAIFTAEQNESIEGYKPEGLQPETKAVQEESKVEEKTDVPAETKGGVG
SIRQPSFVPEPPLEHYEFEGVTENSKRVLSSPLARKLAKERGLDLTTVKGTGPNQRIMSR
DLERAQSTGVVAFGRRVQPTKKPGSYHEESLTPMRKVIAQRLQDAKTFIPHIYVEQTVNA
MLLDQTRDQLRNVDVKVSFNDFVVKACALALVEHPNVNSGFNSANQTIIRFDTIDISIAV
SVSGGLITPIVRHANYKNLGEISLEIRQLARRAKDGKLDASEYKGGSFTVSNLGMYGVTA
FKAIINPPQAAILAVSGIQNVPVVQNGVVVPGKIMNICLSADHRVVDGVAAAEFVKTVQK
YLENPASLLF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccatttactttgactatgccaaaactttcaccaactatggaagaaggaatgattgtt
aaatggcataaaaaagaaggggatcgcgttaacgctaatgatgtgttgctagaggtagca
acggataaggcaacggttgagcacggggctttagatgaagggtggttacgcaaaattatc
gtgaaagaagggggagaagccaaagttaaccaacctattgctattttcacagcagaacaa
aatgaaagcatcgagggttacaagcccgagggattgcagccggaaacgaaagctgtccaa
gaagaatcgaaggttgaagaaaaaacggacgttcctgctgagactaaggggggtgtggga
tccattagacagccctcatttgtgccagagcctccgcttgaacattatgaatttgaaggt
gtcacagaaaattctaaacgtgttttatcatcacctcttgctcgcaagcttgcgaaggag
cgtgggctagacctgacgacggttaaaggaacagggcccaatcaaaggattatgagccgt
gatttggaaagagcgcaatccacgggtgtggtcgcttttggaagacgtgtgcagcccact
aaaaagccgggatcgtatcatgaagaatctttgacgcctatgcgaaaggtaattgctcag
agacttcaagatgccaaaacatttattccgcatatctacgtggagcaaaccgtaaatgct
atgcttttagatcaaacacgtgaccaattgcgtaacgtcgatgtgaaggtctcttttaat
gattttgtggtgaaggcctgcgctttagcgcttgtcgaacatccaaatgtcaacagtggt
tttaattctgcaaatcaaacgattattcgtttcgatacgatcgatatttccatcgctgtg
agtgtttcaggtggactaattacacccattgtacggcatgcgaattataaaaatttggga
gagatctctctggagattcgacagttagccagaagggccaaagatggcaagctagacgcg
tcagaatataaaggtggatcttttactgtttcgaatttaggcatgtatggcgtaactgct
tttaaagcgattattaatccaccccaagcggctattttagctgtaagcggtattcaaaat
gtccctgtggttcagaatggggtagttgttcctggaaaaatcatgaatatttgcctgtca
gctgaccatcgagtggtggatggtgtggcagcagctgaatttgtgaaaacagttcaaaaa
tatctagaaaatccagcgtcccttcttttttaa

DBGET integrated database retrieval system